Details for Eucalyptus Locus Eucgr.H00600

Position : scaffold_8 ( 5`- 8158148 .. 8169569 -3` )
Annotation :
External links : CoGe
PGDD synteny : Eucgr.H00600

Protein [Map View]
MADHERDEVPMLLEMQHQLSDDSNSSRRQAFVSRTRSASMSIPTSSMESHENIPNLVGYTGPLRSEKRMPFSQMSGPLYI
GHGPEKAVRRNHVVPGRKLVESQYMREKFPSFGIKDRIDSTDDHYAAKNEHLQRSGQLGLCNDPYCTTCPSYYNKRAQHS
SFKSSSIFDPKFHNALYGDAKGWARRFFSYVNAHIPRVMNPHAQVVQRWNKFFVISCLVAVFIDPLFFLVLSVQKDYMCI
ILNQAMTITVVVFRSMTDFIYLLHILLQFRLAYIAPETRVVGAGDLVDHPKKIALHYLRGYFFIDLFVAFPLPQILILLV
VPTFKRSSAANYAKNLLRAGVLIQYIPRLYRVLPLLAGQSPTGFIFESAWANFVINLLMFVLAGHVVGSCWYLLGLQRVN
QCLREACKPADLCRFMDCGNGDNIDKFRKDAEWTNWTTNPNATACFNSNDFGYGIYQNAVNLTQEASLVTRYVFSLFWGF
QQISTLAGNQTPSYFVPEVLFTMGIIGLGLLLFALLIGNMQNFLQALGRRRLEMSLRRRDVEQWMSHRRLPEQLRRRVRE
AERYHWAATRGVNEEMLLEDFPEDLQRDIRRHLFKFVKRVRIFAVMEDHIIDAICEKLRQKTYIKGSKILHPGVLVEKLI
FIVRGKIESRGEDGVTSLCEGDICGEELLAWCLESSSVNKDGRKIRPPGNRLMSNRTVTCVTNVEAFALRAEDLEEVTRL
FARFLRNPKVQGAIRYVSPYWRGLATTRIQVAWRYRKKRLSRADTSQSQHP*

DNA
ATGGCTGATCATGAAAGAGATGAAGTACCGATGCTGTTGGAGATGCAGCACCAATTATCAGATGATTCTAACAGTTCTCG
ACGTCAGGCATTTGTATCTAGGACCCGCAGCGCATCGATGTCCATCCCTACGAGCTCCATGGAGTCGCATGAAAATATAC
CTAATCTAGTAGGTTATACTGGACCTCTAAGGAGTGAAAAGAGGATGCCTTTTTCACAAATGAGCGGCCCTTTGTACATC
GGTCATGGACCTGAAAAGGCCGTCAGGCGTAACCACGTTGTGCCTGGAAGAAAGCTAGTGGAGTCACAATATATGCGAGA
AAAATTCCCTTCTTTTGGTATAAAGGATCGCATCGACTCCACTGATGATCACTATGCTGCTAAAAATGAGCATTTACAGA
GGTCTGGGCAACTGGGGCTGTGCAATGACCCCTACTGTACAACTTGTCCCTCATATTATAATAAAAGAGCGCAACATTCG
AGTTTCAAAAGTTCTAGTATATTTGATCCCAAGTTTCACAATGCTCTCTATGGGGATGCCAAAGGTTGGGCAAGGAGATT
CTTCTCTTATGTCAATGCCCACATTCCTCGCGTTATGAATCCTCATGCTCAAGTGGTCCAGCGGTGGAACAAATTTTTTG
TCATTTCTTGCTTGGTTGCTGTCTTTATAGACCCATTATTCTTCTTGGTGCTGTCTGTTCAAAAGGATTATATGTGTATA
ATTTTAAACCAGGCCATGACAATAACAGTCGTTGTTTTTAGAAGCATGACGGACTTCATATACCTATTGCACATTCTTCT
TCAGTTTAGGCTGGCTTACATAGCTCCTGAGACTAGGGTGGTTGGTGCTGGTGATTTAGTTGACCATCCAAAAAAAATCG
CTCTCCATTATCTGCGAGGATACTTCTTCATAGATCTTTTTGTCGCATTTCCACTTCCGCAAATATTGATATTGCTAGTT
GTACCAACATTCAAGCGTTCGTCTGCAGCAAATTATGCAAAGAATCTATTACGCGCAGGCGTTCTTATCCAGTACATTCC
CAGATTATATCGAGTTTTGCCCTTACTTGCGGGTCAGTCTCCTACTGGCTTCATTTTTGAGTCGGCATGGGCAAATTTTG
TCATCAATCTTCTCATGTTTGTGTTGGCTGGCCATGTTGTTGGATCATGCTGGTACCTTCTTGGGCTACAGAGGGTTAAT
CAATGTCTTCGGGAAGCATGCAAACCAGCTGACCTGTGTCGCTTTATGGATTGTGGAAATGGAGACAACATTGACAAATT
CAGAAAGGATGCAGAATGGACTAACTGGACAACAAATCCGAATGCTACTGCTTGTTTTAACTCCAATGATTTTGGTTATG
GAATTTACCAAAATGCTGTTAATCTTACCCAAGAAGCAAGCCTGGTCACGAGATATGTGTTTTCATTGTTTTGGGGATTC
CAGCAAATAAGTACTCTAGCTGGAAATCAAACTCCAAGCTACTTTGTTCCAGAAGTCCTGTTTACCATGGGCATTATTGG
ATTGGGCCTCTTGCTCTTTGCTCTTCTCATTGGAAATATGCAGAACTTCCTCCAGGCTCTCGGAAGAAGGAGGCTAGAAA
TGTCATTAAGGCGTCGTGATGTTGAGCAATGGATGAGTCACAGACGCTTACCTGAACAGCTAAGAAGAAGAGTACGCGAA
GCTGAGCGATACCATTGGGCTGCCACTAGAGGAGTCAATGAAGAAATGCTTCTCGAGGATTTTCCTGAAGATCTTCAGAG
GGATATAAGACGCCATCTCTTCAAATTTGTGAAAAGAGTGAGAATATTTGCAGTAATGGAGGATCACATCATAGATGCAA
TTTGTGAGAAGTTACGGCAAAAAACATACATCAAAGGAAGCAAGATCCTGCATCCTGGTGTTCTTGTTGAAAAGTTGATT
TTCATTGTCCGCGGGAAAATTGAGAGCAGAGGAGAAGACGGCGTTACAAGTTTATGTGAAGGAGATATATGCGGGGAAGA
GCTTCTAGCTTGGTGCCTTGAGAGTTCTTCTGTAAACAAAGATGGACGAAAGATAAGACCACCTGGAAACCGGTTGATGA
GTAACAGGACAGTAACATGTGTGACAAATGTTGAAGCCTTTGCACTTCGAGCGGAAGACCTTGAAGAAGTCACCAGGTTA
TTTGCAAGATTCCTGCGCAATCCAAAAGTTCAAGGAGCCATAAGGTATGTATCACCATACTGGAGGGGACTTGCAACAAC
TCGTATCCAAGTTGCTTGGAGATACAGGAAGAAACGACTAAGCCGTGCCGACACTTCACAGTCACAGCATCCTTAA