Details for Eucalyptus Locus Eucgr.H00595

Position : scaffold_8 ( 5`- 8123411 .. 8127308 -3` )
Annotation :
External links : CoGe
PGDD synteny : Eucgr.H00595

Protein [Map View]
MVVTTTVSDSDESIHSTFASRYVRNSLPKFKMPEQSIPKEAAYQIINDELMLDGNPRLNLASFVTTWMEPECDKLMMAAI
NKNYVDMDEYPVTTELQNRCVNMIAHLFNAPMGDKETAVGVGTVGSSEAIMLAGLAMKRKWQKRRQAEGKPYDKPNIVTG
ANVQVCWEKFARYFEVELKEVKLREGYYVMDPVKAVEKVDENTICVAAILGSTLTGEFEDVKLLNDLLTKKNRETGWDTP
IHVDAASGGFIAPFLYPHLKWDFRLPLVKSINVSGHKYGLVYAGVGWVVWRDKEELPEELIFHINYLGSDQPTFTLNFSK
GSSQIIAQYYQFIRLGFEGYKDIMENCMVNARMLCEGIVKTGRFNILSKEEGVPVVTFSLKDSSRYTVFDISEDLRRFGW
IVPAYTMPPDAEHVAVLRVVVREDFSRGLAERLTTDIERVVKELDGKPPSRGTVKAAHVTAAVEGAGGEKRLKKSVEETQ
REITSHWKRLVDGKRKGAC*

DNA
ATGGTGGTCACCACGACGGTGTCGGACTCCGATGAGAGTATTCACTCCACTTTCGCCTCCAGATACGTCCGCAATTCTCT
TCCCAAGTTCAAGATGCCGGAGCAGTCGATACCGAAAGAAGCAGCTTACCAGATAATAAACGATGAACTGATGTTGGATG
GGAATCCGAGGCTGAACTTGGCTTCTTTCGTGACCACGTGGATGGAGCCGGAGTGCGATAAGCTGATGATGGCTGCGATC
AACAAGAATTATGTCGATATGGATGAATACCCTGTCACCACAGAGCTCCAGAACCGGTGCGTTAACATGATAGCTCACCT
GTTCAATGCTCCCATGGGGGATAAAGAGACTGCTGTTGGTGTCGGGACGGTGGGGTCATCTGAGGCTATTATGTTGGCAG
GGTTGGCAATGAAGAGGAAGTGGCAGAAAAGAAGGCAGGCTGAAGGAAAACCCTATGATAAGCCGAATATTGTTACTGGA
GCCAATGTGCAGGTTTGCTGGGAGAAGTTCGCTAGGTACTTTGAGGTCGAGCTGAAGGAAGTGAAACTGAGGGAGGGTTA
TTATGTGATGGACCCGGTGAAAGCTGTTGAGAAGGTCGACGAGAATACCATATGTGTTGCAGCGATACTCGGCTCGACCT
TAACTGGAGAATTCGAGGATGTGAAGCTCCTTAATGATCTCCTTACTAAGAAGAACAGGGAAACCGGATGGGACACTCCC
ATTCACGTCGATGCTGCGAGCGGAGGGTTCATTGCCCCGTTCTTGTACCCGCATCTGAAATGGGATTTCCGTCTACCCCT
GGTTAAGAGCATTAACGTTAGCGGTCACAAGTATGGCCTTGTCTATGCCGGTGTCGGATGGGTCGTCTGGAGGGACAAGG
AAGAGCTGCCCGAGGAACTCATCTTTCACATTAATTACCTCGGATCTGATCAACCCACTTTCACACTCAACTTTTCTAAA
GGTTCGAGTCAAATTATAGCTCAGTATTATCAGTTTATAAGGCTGGGGTTCGAGGGATACAAAGACATCATGGAGAACTG
CATGGTGAACGCTCGCATGCTGTGCGAGGGGATCGTCAAGACGGGCCGGTTCAACATACTGTCGAAGGAAGAAGGCGTGC
CGGTCGTCACCTTCTCCCTCAAGGACAGCAGCCGGTACACAGTGTTCGACATCTCAGAGGACCTGAGGAGGTTCGGGTGG
ATCGTGCCGGCGTACACAATGCCGCCGGACGCGGAGCACGTGGCCGTCCTCCGGGTCGTGGTCCGGGAGGACTTCAGCAG
GGGGCTCGCGGAGAGGCTCACGACGGACATCGAGAGGGTCGTGAAGGAGCTGGACGGGAAGCCACCGAGCCGCGGCACGG
TCAAGGCGGCCCACGTGACGGCAGCCGTGGAGGGGGCGGGGGGCGAGAAGCGCTTGAAGAAGAGCGTGGAGGAGACGCAG
AGGGAGATCACAAGCCATTGGAAGAGGCTGGTGGATGGCAAGAGGAAAGGGGCTTGCTAA