Details for Eucalyptus Locus Eucgr.H00591

Position : scaffold_8 ( 5`- 8087907 .. 8097245 -3` )
Annotation :
External links : CoGe
PGDD synteny : Eucgr.H00591

Protein [Map View]
MADGSSVDVILDFLRRNKFTRAEEALRSEITNRSDLNGFLQNLTLEEKDTGKFPQGQNGEKPAVVNQGPNSRDGGEASEE
LIVKEIECGTTRSGPDSRSKGTVVEQSKHVEMSSNTSKGFTFPKGSERNSGDLQPWKFNSSNGPSDLYENDVCRSSHTMS
DLKVSGASYSGKANVFTREDVKFAGEKDAWVVSSSKNHSEPFGEPREVGKQAKVSNVYSKDGSDDNPWSTNEELASISAD
PWKDCSIKTVFPFTKGETSNNYDIIIPHDKKEGKKKAETINDVRVAIKDQVDEVGRALYFGKTQGGFDQKNISSLGFPFP
YENPKEELPRLPPVKLKSEEKSISNNWEEKYDRDGMGAKLASIDSTFLIGSFLDVPVGQEINSSGGKRLGGGNWLSVSHG
IAEDTSDLVSGFATIGDGLSESIDYPNEYWDSDEYDDDDDVGYMRQPIEDETWFLAHEIDYPSDNEKGTGHGSVPDPQEG
GQIKDEDDDQSFAEEDSYFSGERFLQSKNVEPVTASDDPMGLSAREVYGRVEENDLITQYDGQLMDEEELNFMRAEPVWK
GFVAQTDELIMLGDEKVLNDRGRPQLDDICLDDDQHGSVRSIGVGINSDAADFGSEVRESLVGGSSEGDLEYIPDHDVGP
ASKHYKIEADKNYSNRLSREQRRKYKLDPNQYIIGNDKSIQTGVKGQIDGGFSFPPPLRDEQLLHASSSKSLWSENSNAV
VNDVAEQRLNASMGTDDMLATWKRKSSDSSTVKSSRDEDNANAVRSANSSPSSLSNYGYAERDCIKKEEDEKPAVREDDA
VASLEDEEAAAVQEQVRQIKAQEEEFETFNLKIVHRKNRTGFEEDKNFHVVLNSVIAGRYHVTEYLGSAAFSKAIQAHDL
HTGMDVCVKIIKNNKDFFDQSLDEIKLLKYVNKHDPGDKYHLLRLYDYFYYREHLLIVCELLKANLYEFHKFNRESGGEV
YFTMPRLQSITIQCLEALRFLHGLGLIHCDLKPENILVKSYSRCEVKVIDLGSSCFETDHLCSYVQSRSYRAPEVILGLP
YDKKIDVWSLGCILAELCTGNVLFQNDSPATLLARVIGIIGPLNQDMLAKGRDTYKYFTKNHMLYERNQDTNRLEYLIPK
KTSLRHRLPMGDQGFIDFVSHLLEVNPKKRPTAADALKHPWLSYPYEPISS*

DNA
ATGGCTGATGGCAGCTCTGTGGACGTGATTCTAGATTTTCTCCGAAGAAATAAATTCACCCGAGCAGAGGAGGCTCTGCG
CAGTGAGATCACAAATCGCTCTGATTTGAATGGGTTCCTTCAGAACCTCACGCTTGAGGAGAAGGACACAGGCAAGTTTC
CACAAGGACAAAATGGCGAGAAACCAGCTGTTGTGAATCAGGGCCCTAATTCTCGAGATGGTGGTGAAGCTTCTGAGGAA
CTCATCGTGAAAGAAATAGAGTGTGGCACCACCAGAAGTGGTCCAGACAGCAGATCCAAGGGTACTGTGGTTGAACAAAG
CAAACATGTGGAGATGTCGAGTAACACCAGCAAGGGCTTTACCTTCCCTAAAGGTTCAGAAAGGAATTCGGGTGATCTGC
AGCCATGGAAATTTAATTCTAGCAATGGGCCTTCAGATCTTTATGAAAATGATGTTTGCAGGAGTTCTCATACCATGTCT
GATCTGAAGGTCTCCGGGGCTTCTTATTCTGGCAAAGCTAATGTTTTTACTAGAGAAGATGTTAAATTTGCTGGTGAAAA
GGATGCATGGGTTGTCAGTTCTAGCAAAAACCATTCTGAACCCTTTGGTGAACCTAGGGAAGTCGGCAAACAAGCAAAAG
TTAGCAATGTCTACTCTAAGGATGGTTCCGATGATAATCCATGGTCTACAAATGAGGAGCTTGCATCAATATCAGCTGAC
CCATGGAAAGATTGTTCAATTAAAACAGTTTTTCCATTCACGAAAGGGGAGACTTCAAACAATTATGACATTATCATTCC
TCATGACAAAAAGGAAGGAAAGAAAAAGGCAGAGACGATCAATGATGTTCGGGTGGCTATTAAGGATCAGGTAGATGAGG
TTGGCAGAGCATTGTACTTTGGAAAGACACAAGGAGGTTTTGATCAAAAGAATATTAGCAGCTTAGGGTTTCCATTTCCA
TATGAGAACCCAAAGGAAGAACTGCCTAGGTTGCCCCCAGTCAAACTCAAGTCAGAGGAAAAGTCCATTTCCAACAATTG
GGAAGAGAAGTATGATCGCGATGGAATGGGTGCAAAGCTTGCGAGCATTGACAGTACGTTCCTTATAGGTTCATTTCTGG
ATGTTCCTGTAGGACAAGAAATTAATTCTTCAGGTGGGAAAAGGCTTGGTGGTGGCAATTGGCTATCTGTAAGTCATGGC
ATCGCAGAGGATACATCTGATCTGGTTTCGGGTTTTGCAACTATTGGAGATGGGTTGAGTGAGTCTATTGACTACCCTAA
CGAGTATTGGGATTCTGATGAGTATGACGACGACGATGATGTTGGATATATGAGGCAGCCTATTGAGGATGAGACCTGGT
TTCTGGCCCATGAAATAGACTATCCTAGTGATAATGAGAAGGGAACTGGCCATGGGAGTGTTCCTGACCCGCAGGAAGGA
GGTCAAATTAAAGATGAGGACGACGACCAATCCTTTGCCGAGGAGGATTCTTACTTCTCTGGGGAGCGATTTCTTCAATC
AAAAAACGTGGAACCAGTTACAGCTTCAGATGATCCGATGGGGCTGTCAGCGAGAGAAGTTTACGGCAGGGTGGAGGAGA
ATGATTTAATCACACAATATGATGGACAACTGATGGATGAGGAAGAACTGAATTTCATGCGTGCGGAACCTGTATGGAAA
GGTTTTGTTGCACAGACAGATGAACTCATCATGTTAGGGGATGAGAAAGTTCTAAATGATCGTGGAAGGCCGCAACTGGA
TGATATATGTCTTGATGATGATCAACACGGTTCTGTTAGATCAATTGGTGTAGGCATCAACAGTGATGCTGCTGATTTTG
GTAGCGAAGTCCGGGAAAGTTTAGTTGGGGGCAGCAGCGAGGGAGATTTAGAGTACATCCCTGATCATGATGTCGGACCT
GCATCCAAACACTATAAAATTGAAGCAGATAAAAATTACAGTAATAGGTTGAGCAGGGAACAAAGGAGAAAGTATAAGCT
TGATCCCAACCAATATATCATTGGGAATGACAAAAGCATACAAACAGGAGTGAAGGGTCAAATAGATGGGGGTTTTTCAT
TCCCTCCTCCATTGAGGGATGAGCAGTTGCTTCATGCAAGCTCTAGCAAATCCTTATGGTCAGAGAACTCCAATGCTGTT
GTGAATGATGTAGCTGAGCAGAGACTGAATGCTTCCATGGGAACTGATGACATGCTAGCCACATGGAAAAGGAAAAGCAG
CGACTCTTCCACTGTTAAAAGTTCAAGAGATGAAGATAATGCGAATGCTGTAAGATCGGCAAATTCTTCTCCATCTTCGC
TATCAAATTATGGTTATGCTGAAAGAGACTGCATCAAGAAAGAAGAGGATGAAAAGCCAGCTGTGAGAGAGGATGACGCA
GTGGCATCCCTGGAGGATGAGGAAGCTGCTGCGGTGCAGGAGCAAGTAAGGCAAATCAAGGCTCAGGAAGAGGAATTTGA
GACTTTTAATCTCAAGATTGTCCACAGGAAAAACAGAACCGGCTTTGAGGAGGACAAGAACTTTCACGTTGTTTTAAATT
CAGTCATTGCTGGGCGGTATCATGTCACCGAATATCTTGGCTCTGCTGCATTTAGTAAGGCCATACAAGCTCATGATCTG
CATACAGGCATGGATGTATGTGTTAAAATTATAAAAAACAACAAAGACTTCTTTGATCAGAGCCTGGATGAAATAAAGCT
TCTCAAGTATGTCAACAAACATGATCCTGGCGACAAGTACCACCTCCTCCGTTTGTATGATTATTTTTACTACCGAGAGC
ATTTGTTGATAGTATGCGAACTACTTAAAGCAAACTTATACGAGTTTCACAAATTCAATAGAGAGTCTGGAGGGGAAGTT
TACTTCACTATGCCTAGATTGCAGTCAATAACTATTCAGTGTTTGGAAGCACTTCGATTCTTGCATGGCCTTGGCCTCAT
CCACTGTGATCTCAAGCCTGAGAATATATTGGTAAAAAGCTACAGCAGATGTGAAGTAAAGGTCATTGATCTCGGGAGTA
GTTGTTTTGAAACAGATCATTTATGCTCCTATGTTCAGTCACGATCTTATCGGGCTCCAGAAGTTATTCTGGGATTGCCA
TATGATAAGAAGATTGACGTATGGTCACTTGGCTGCATATTGGCAGAACTTTGCACTGGAAATGTTCTCTTCCAAAATGA
CTCACCTGCAACACTACTTGCACGTGTCATTGGGATTATTGGCCCCCTCAATCAAGACATGCTAGCAAAAGGCAGAGACA
CGTACAAATACTTTACGAAAAATCATATGCTGTATGAGCGGAATCAGGATACCAACAGACTGGAATATCTGATACCAAAG
AAGACGTCTTTAAGGCACCGATTGCCTATGGGGGACCAAGGATTTATTGACTTTGTCTCCCATCTACTTGAGGTAAATCC
AAAGAAACGCCCCACTGCTGCTGACGCTTTGAAGCACCCGTGGCTGTCATATCCATACGAACCGATATCCTCTTGA