Details for Eucalyptus Locus Eucgr.H00571

Position : scaffold_8 ( 5`- 7856597 .. 7864889 -3` )
Annotation :
External links : CoGe
PGDD synteny : Eucgr.H00571

Protein [Map View]
MASQGKKLINDPKDVVTEYIEGLVETYPGLQHLDGFPEVKVVLRADVSSETYDKVAVICGGGSGHEPAQAGYVGEGMLTA
AICGDVFVSPPVDSILAGIRAVTGPMGCLLIVTNYTGDRLNFGLAAEQAKAEGYKVETVIVGDDCALPPRRGIIGRRGLA
GTILVNKVAGAAAAAGLSLAEVAAEAKHASEVIGTMGVALSVCTLPGLVTSDRLGPEKIELGLGIHGEPGAAVADLQPVD
VIISHMLQQILSTETGYVPITRGNGVILMVNGLGATPVMELMIAAGKAVPKLQLEHGLAVDRVYTGSFMTSLDMGGFSIT
IMKSDESILRRLDAPTKAPYWPVAVDGSRPPAKIPIAMPLSRSTKSDESLCWPLKLTQQGNLLEMAVEAALNAIIGLADS
LNEWDAKVGDGDCGSIMYKGATAVLDDMKKHYPLNDAAETISEIGSSIRRVMGGTSGILYVIMCKAASPHLKANRQADVT
AKQWAEALEAAITAVSKYGGASAGYRTLLDALIPASQVLKERLDAGDDPVTAFVLSSEAAVAGAESTVHMQAQAGRSSYV
SEDVLATAPDPGAMAVASWYRAAALAVKDNYKVA*

DNA
ATGGCTTCCCAGGGGAAGAAGCTCATCAACGATCCCAAAGACGTGGTGACCGAGTACATCGAAGGTCTCGTCGAGACTTA
TCCTGGATTGCAGCATCTCGACGGTTTTCCCGAGGTGAAGGTGGTGCTGCGAGCCGATGTTTCGAGCGAGACGTACGATA
AGGTCGCGGTGATCTGCGGAGGTGGAAGCGGGCATGAACCTGCACAAGCTGGTTATGTCGGGGAAGGGATGCTTACAGCA
GCAATATGCGGAGATGTTTTTGTATCTCCTCCCGTTGATTCAATTCTAGCTGGCATCCGAGCCGTAACTGGTCCCATGGG
ATGCCTTCTTATTGTCACGAATTACACCGGTGATCGTTTAAACTTTGGTTTGGCTGCTGAGCAAGCTAAAGCTGAAGGTT
ATAAAGTGGAGACTGTGATTGTCGGAGATGATTGTGCTTTACCTCCTCGGCGAGGCATAATAGGACGGAGAGGTTTGGCT
GGGACGATCCTTGTGAACAAGGTTGCCGGAGCAGCTGCCGCTGCTGGTCTGTCTCTCGCCGAAGTTGCTGCAGAAGCTAA
ACATGCATCTGAAGTAATTGGAACAATGGGCGTTGCATTATCTGTTTGCACACTTCCAGGTCTGGTTACATCAGATCGTT
TGGGCCCAGAGAAGATTGAACTTGGTCTGGGGATCCATGGAGAACCAGGCGCTGCTGTGGCTGACCTTCAACCAGTGGAT
GTTATAATATCTCATATGCTTCAGCAGATATTATCTACGGAAACTGGCTATGTTCCTATAACACGAGGTAATGGAGTGAT
ACTCATGGTCAACGGGTTAGGTGCTACCCCTGTGATGGAGTTAATGATTGCTGCGGGAAAAGCAGTACCTAAGCTGCAGC
TGGAACATGGATTGGCTGTTGATAGAGTTTATACGGGATCTTTTATGACTTCTCTTGACATGGGAGGTTTCTCCATTACA
ATCATGAAATCTGATGAATCAATTCTGCGACGTCTGGATGCTCCTACTAAGGCTCCCTATTGGCCTGTTGCTGTTGATGG
CAGTCGCCCTCCTGCAAAAATTCCTATTGCAATGCCATTGTCTCGTTCAACAAAGAGTGATGAGTCATTGTGTTGGCCGC
TAAAGTTAACTCAACAAGGCAATCTTCTTGAAATGGCTGTAGAAGCAGCATTGAATGCAATTATTGGGTTGGCTGACAGT
TTGAATGAATGGGATGCCAAAGTAGGCGATGGTGACTGTGGCTCAATTATGTATAAAGGCGCAACAGCTGTCCTGGATGA
TATGAAAAAGCATTATCCTCTAAATGATGCTGCAGAAACTATAAGCGAAATCGGTTCATCCATCAGGAGAGTCATGGGGG
GTACCAGCGGGATACTATATGTCATAATGTGCAAGGCAGCATCTCCACACTTGAAAGCAAACCGCCAGGCTGATGTTACA
GCAAAACAATGGGCCGAAGCACTTGAAGCAGCCATCACTGCAGTCAGTAAATATGGTGGTGCCAGTGCTGGTTATCGCAC
GCTGTTAGATGCCCTTATCCCAGCATCTCAAGTTCTCAAAGAGAGGTTAGATGCTGGGGATGACCCCGTCACAGCTTTTG
TGCTCTCGTCAGAAGCAGCAGTGGCTGGTGCTGAGTCAACAGTGCACATGCAGGCTCAGGCTGGTCGCTCAAGCTATGTC
TCTGAAGATGTCCTTGCGACTGCGCCAGACCCCGGAGCCATGGCTGTAGCTTCCTGGTATAGAGCAGCGGCCTTAGCTGT
GAAGGATAACTATAAAGTCGCATGA