Details for Watermelon Locus Cla018437

Position : Chr4 ( 5`- 22031703 .. 22032406 -3` )
Annotation :
External links : CoGe
PGDD synteny : Cla018437

Protein [Map View]
MEILRRTDSPYVVQCHGIFEKPSGDVTILMEYMDLGSLDSLLKKNSTLSESTLAHVSRQVLNGLHYLHSHKIIHRDIKPS
NLLVNKNMEVKIADFGSRAVYGGNYNGYAGDIWSLGLTLLELYLGHFPFLPPGQRPDWATLMCAICFGEPPTLPENASEE
FRSFVECCLQKESSKRWTAAQLLTHPFVCRESSRSDRLIGGGLKDSESLAV

DNA
ATGGAGATTCTGCGCCGTACTGATTCTCCCTATGTCGTTCAGTGCCATGGAATCTTCGAGAAGCCTTCTGGAGATGTAAC
GATTTTGATGGAGTATATGGATCTAGGATCGCTTGATTCACTTTTGAAAAAGAATTCGACGTTGTCGGAATCGACGCTTG
CTCACGTATCGCGTCAAGTTCTTAACGGACTTCATTATCTTCATTCTCACAAAATCATTCATCGCGATATTAAACCGTCG
AACCTGTTGGTGAATAAGAATATGGAGGTTAAGATTGCTGATTTTGGATCCAGAGCGGTTTACGGCGGAAATTACAACGG
TTACGCCGGTGATATTTGGAGTTTGGGGCTTACTCTTCTGGAACTTTATTTAGGTCATTTTCCTTTTCTTCCGCCTGGAC
AGAGACCGGATTGGGCGACTCTGATGTGTGCGATTTGCTTCGGTGAACCACCTACACTGCCGGAGAATGCGTCGGAGGAG
TTTCGAAGCTTTGTTGAGTGTTGCTTGCAGAAGGAATCTAGCAAGAGGTGGACGGCGGCGCAATTGTTGACGCATCCGTT
TGTATGCAGGGAATCATCGAGATCCGATCGATTAATCGGCGGTGGATTGAAGGATTCCGAATCACTGGCAGTTTAA