Details for Watermelon Locus Cla018433

Position : Chr4 ( 5`- 21987867 .. 21991151 -3` )
Annotation :
External links : CoGe
PGDD synteny : Cla018433

Protein [Map View]
MPMEPIVKGNPTVLSSSSSSSLILTSGASGRVNALLTMRALKSLIMLVNAFILLLLVPFRGRKRAQAAADKPRDEKQERK
CPTVRVPATIVSWKSSSSSINNNNNINSSSPTVAVAVDQEVAVRRALAIRRVVEDKDKSEASVREFLLFQSPRGNVLFTQ
SWTPVSLKIRGLVVLLHGLNEHSGRYSDFAKQLNANGYKVFGMDWIGHGGSDGLHAYVHSLDDAVFDLKSYLQKVLADNP
GLPCFLFGHSTGGAIVLKAVLDPSISSCISGVVLTSPAVGVQPSHPIYAVLAPIVSLLFPTLQVGAANKTSLPVTRDPDA
LVAKYSDPLVYTGAIRVRTGYEILKISSYLQQNLSKICIPFLVLHGTADEVTDPTASQKLYDEASSTDKSIRLLQGLLHD
LLFEPERQSIMNDIIDWMNGRL

DNA
ATGCCTATGGAGCCGATTGTGAAGGGGAATCCCACGGTGTTGTCGTCCTCATCCTCGTCGTCGCTCATTCTAACCTCCGG
TGCGAGCGGTCGCGTAAACGCATTGCTGACGATGCGAGCTTTGAAGAGTTTGATCATGTTGGTTAATGCCTTCATTTTGT
TGTTGCTAGTGCCTTTCCGCGGCCGGAAGCGAGCGCAAGCGGCAGCGGATAAGCCGAGAGACGAAAAGCAGGAAAGGAAA
TGCCCGACGGTTCGGGTTCCCGCGACAATTGTCTCTTGGAAGAGCAGCAGCAGTAGTATTAACAATAATAATAATATCAA
CTCTTCGTCGCCGACCGTGGCGGTGGCGGTGGATCAGGAGGTGGCGGTGAGACGAGCTCTGGCAATACGGAGGGTGGTGG
AGGATAAGGATAAAAGTGAGGCTTCAGTACGAGAGTTTCTTCTCTTTCAATCCCCAAGAGGAAATGTACTCTTTACCCAA
TCGTGGACGCCTGTATCTCTTAAGATAAGGGGACTGGTGGTTCTCTTGCATGGATTAAATGAACACAGTGGTAGATACAG
TGATTTTGCCAAGCAATTAAATGCAAATGGCTACAAGGTTTTCGGCATGGATTGGATTGGTCATGGTGGGAGCGATGGAT
TGCACGCGTATGTTCATTCTCTTGATGATGCGGTTTTTGATTTGAAATCATATCTTCAGAAGGTTTTGGCTGATAACCCG
GGCTTGCCTTGTTTCTTATTTGGACATTCCACAGGAGGAGCCATTGTTCTCAAGGCGGTGCTCGACCCTAGTATCAGTTC
TTGCATATCTGGAGTCGTGCTTACATCACCTGCAGTTGGAGTTCAACCATCTCACCCCATCTATGCAGTCCTTGCCCCCA
TAGTCTCATTATTGTTTCCGACGCTCCAAGTTGGTGCTGCAAACAAGACGAGCCTTCCGGTGACTCGAGACCCAGATGCA
TTGGTAGCTAAATATTCCGATCCTCTAGTCTACACGGGAGCCATCCGGGTGAGAACCGGCTACGAGATTCTCAAGATCTC
TTCATATTTGCAGCAGAATTTAAGCAAAATATGCATCCCATTCCTAGTTCTCCACGGCACTGCCGATGAAGTAACTGACC
CAACAGCCTCCCAAAAGCTTTACGACGAAGCCTCATCGACTGACAAATCCATCAGATTGCTTCAAGGTCTCCTACATGAT
CTCCTATTTGAACCAGAAAGGCAGAGTATTATGAATGACATAATTGATTGGATGAATGGTAGATTGTAA