Details for Watermelon Locus Cla010312

Position : Chr9 ( 5`- 30152771 .. 30156481 -3` )
Annotation :
External links : CoGe
PGDD synteny : Cla010312

Protein [Map View]
MLFASSLEQGVENEVEFFSRLDDEFNKLVGFYKKEVGELMREAEELSKQMVILIALRVKVEKPDFSFEDSNEHVSLTGIT
PSSTSTSTVKSTIPRTPGCSRLEVTQEVEIAEETSLEDAKSYHRKPSRGIVQPTIQKLKPVSLELLPQTELRKAEELMMR
ALIEFYQKLRLLKGYSFLNKLAVVKIMKKYDKVTRLRERVEAVFIKHFANGNHRRGMDILKRKIRRDRQGITFFSGFIFG
CSTALVVAIILVIHLRNIFKSQGLGQYMDNIFPLYSFFGFIVLHMLMYSANIYFWRRYLVNYTFMLGFKQGTELGCWEVF
FLSSGLAVITLACVLSNLDMEADPRTKSFAAITESIPLALLIVSLQDFFLADQLTSQVLNILLRLAWMQSVLGFREAPFI
HRQALIAIVAMLEIIRRGIWNFFRMENEHLNNVGKFRAFNSVPLPSEYDNNKMKLGCHL

DNA
ATGTTGTTTGCTTCATCTTTGGAGCAAGGGGTTGAAAATGAGGTGGAATTCTTCAGTAGACTTGATGATGAGTTCAATAA
ACTGGTGGGGTTTTACAAGAAGGAAGTGGGGGAGTTAATGAGGGAGGCTGAGGAGTTGAGCAAACAGATGGTTATTTTGA
TTGCTCTTCGGGTTAAGGTAGAGAAGCCAGATTTTTCTTTTGAAGATTCTAATGAACATGTCAGTCTTACAGGTATTACA
CCTTCCTCAACTTCTACTTCAACTGTTAAGTCCACCATTCCCAGAACTCCAGGATGTTCACGATTGGAGGTAACTCAAGA
AGTTGAGATAGCTGAGGAGACATCTTTGGAAGATGCAAAAAGCTATCACAGGAAGCCTAGTAGAGGAATAGTTCAACCTA
CCATTCAAAAACTCAAACCAGTTTCATTAGAATTGTTGCCCCAAACAGAGTTGAGGAAGGCAGAGGAACTCATGATGCGT
GCCCTCATTGAATTCTACCAAAAGCTTCGGCTTTTAAAAGGCTATAGTTTCTTGAATAAACTGGCCGTTGTGAAGATCAT
GAAGAAATATGATAAGGTTACAAGGCTCAGAGAAAGGGTAGAGGCAGTTTTCATTAAGCACTTTGCAAATGGAAACCATA
GAAGAGGGATGGACATTTTGAAAAGAAAAATCAGAAGGGATAGACAAGGAATTACCTTTTTCTCTGGTTTTATCTTTGGC
TGCTCGACTGCACTTGTAGTGGCCATCATTCTTGTCATACACCTACGAAACATCTTTAAGAGTCAAGGGCTTGGCCAGTA
CATGGATAACATATTTCCTCTCTATAGCTTTTTCGGATTCATTGTCTTGCACATGCTGATGTACTCTGCAAATATATACT
TTTGGAGGCGTTACCTTGTCAATTACACCTTTATGCTTGGCTTCAAGCAAGGGACAGAGTTGGGTTGCTGGGAGGTTTTT
TTTCTTAGTTCAGGTCTTGCCGTGATCACGTTGGCTTGTGTCCTCTCCAATTTGGATATGGAGGCAGACCCCAGAACCAA
AAGCTTTGCAGCCATAACTGAATCAATCCCTTTAGCCCTACTCATTGTTAGCCTCCAAGACTTTTTCTTGGCAGATCAGC
TCACTAGCCAGGTACTGAATATCTTGCTAAGACTTGCTTGGATGCAATCAGTACTAGGTTTCAGAGAAGCTCCATTTATC
CACAGACAAGCCTTAATTGCCATTGTCGCCATGTTGGAAATCATTCGACGAGGAATCTGGAATTTCTTCAGGATGGAGAA
TGAGCACCTAAATAATGTGGGGAAGTTCAGGGCATTCAACTCTGTCCCTCTTCCTTCCGAATATGACAACAACAAGATGA
AACTCGGTTGTCACTTATGA