Details for Watermelon Locus Cla010311

Position : Chr9 ( 5`- 30140798 .. 30143479 -3` )
Annotation :
External links : CoGe
PGDD synteny : Cla010311

Protein [Map View]
MLKWSFLISILLGLMFTVADSMRFDLQSGATKCISDDIKTNAMTVGKYSVVNLNEGFPIPDSHKLTVRVSSPHGNTYHNA
DHVESGHFAFTAAESGDYTTCFWAPEQKPPGSVTVEFDWRSGVSSKDWSKVAKKGQVEVMEFELKKLYDTVISIHDEMFY
LREREEEMQQLNRSTNAKMATFSFLSLGVCLSVAGLQLWHLKTFFERKKLL

DNA
ATGCTGAAATGGAGTTTCTTGATTTCCATTCTTTTGGGCCTCATGTTCACCGTTGCTGATTCGATGCGGTTCGATCTTCA
ATCGGGCGCCACCAAATGCATTTCCGATGACATCAAGACCAATGCCATGACCGTCGGCAAATATTCGGTGGTTAATCTCA
ACGAAGGTTTTCCCATTCCCGATTCTCACAAGCTCACTGTCAGGGTCAGTTCGCCTCACGGTAACACGTATCATAATGCG
GATCATGTGGAATCTGGACATTTTGCTTTCACTGCAGCCGAGTCTGGTGATTATACTACTTGCTTTTGGGCTCCGGAACA
AAAGCCCCCAGGTTCAGTTACTGTTGAATTTGATTGGAGGTCTGGTGTTTCTTCTAAGGATTGGTCCAAGGTTGCTAAGA
AAGGCCAGGTTGAAGTAATGGAATTTGAGTTGAAGAAGTTGTACGACACAGTCATCTCCATACATGATGAGATGTTTTAT
CTCCGTGAAAGAGAGGAGGAAATGCAGCAACTGAATAGATCAACAAATGCAAAGATGGCCACCTTTAGTTTCTTATCACT
TGGAGTTTGCTTGTCTGTGGCTGGTTTACAGTTATGGCATCTCAAGACATTCTTTGAACGCAAGAAGTTGCTGTGA