Details for Watermelon Locus Cla010308

Position : Chr9 ( 5`- 30120258 .. 30123900 -3` )
Annotation :
External links : CoGe
PGDD synteny : Cla010308

Protein [Map View]
MSEVFEGYERQYCELSANLSRKCTSASALNGEQKKQKVSEVKAGIDEAEALIRKMDLEARSLPPNVKAVLLAKLREYKSD
LNNLKSEVKRIESGNLNAATRDELLESGMADTLTASADQRSRLMTTTERLGKSSDRIKESRRTMLETEELGVSILQDLHS
QRQSLLHAHNTLHGVDDNIGKSKRILTNMSRRMNKNKWIVTSIIVVLVLAIILILYFKLSK

DNA
ATGAGTGAGGTGTTCGAAGGATACGAACGGCAATACTGCGAGCTTTCGGCGAACCTTTCAAGAAAGTGCACTTCGGCTAG
TGCCCTAAATGGAGAGCAAAAGAAGCAAAAGGTTTCTGAAGTAAAGGCAGGAATTGATGAAGCAGAAGCTCTGATTCGAA
AAATGGATCTTGAGGCCAGAAGTTTGCCGCCTAATGTCAAGGCTGTCCTTCTAGCTAAATTAAGAGAGTACAAATCTGAC
CTCAACAATTTGAAAAGTGAAGTTAAACGCATTGAATCTGGAAACTTAAATGCAGCCACTAGAGATGAGTTGCTGGAATC
AGGAATGGCTGATACACTGACGGCATCAGCTGATCAAAGATCGAGGTTAATGACCACAACAGAGAGGCTGGGTAAGTCTA
GTGATAGAATCAAGGAAAGCCGAAGAACCATGCTAGAAACAGAAGAACTTGGAGTTTCAATTCTCCAAGATTTACACTCC
CAGCGACAGTCTCTCTTGCATGCTCATAATACGCTTCATGGAGTAGATGACAATATTGGGAAGAGTAAGAGAATTTTAAC
CAACATGTCAAGAAGGATGAACAAGAACAAATGGATTGTTACATCCATAATTGTTGTTCTTGTCTTGGCCATCATCCTGA
TATTGTACTTCAAACTTTCCAAATAG