Details for Capsella Locus Carubv10022226m

Position : scaf_2 ( 5`- 11749052 .. 11749465 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10022226m

Protein [Map View]
MSCNIKTTNEEDASSNFGCNICLDLAREPIVTLCGHLFCWPCLYKWLHYHSKSNHCPVCKALVKEDSLVPLYGMGKPSSD
PRSKPSCGVSVPNRPTAARIESARPPLGTRHHGSSFFGGHSGFAAMPTGTRFSNFLL*

DNA
ATGTCTTGTAACATCAAAACCACGAACGAAGAAGATGCATCGAGCAACTTTGGATGCAATATCTGTCTTGACTTGGCAAG
AGAACCGATCGTGACTCTATGTGGTCATTTGTTCTGCTGGCCTTGTCTCTACAAATGGCTCCATTATCATTCCAAATCGA
ATCATTGTCCTGTTTGTAAAGCTCTGGTTAAGGAAGACAGTTTGGTTCCTTTGTATGGAATGGGCAAGCCATCTTCTGAT
CCCAGATCGAAGCCAAGTTGTGGTGTTTCTGTCCCCAATCGACCAACTGCGGCTAGGATTGAATCAGCTCGTCCTCCGCT
TGGGACAAGGCATCATGGCTCTAGTTTCTTTGGAGGGCATTCAGGATTTGCTGCCATGCCAACTGGTACACGGTTTTCCA
ACTTCTTGTTGTAA