Details for Capsella Locus Carubv10022189m

Position : scaf_2 ( 5`- 11797421 .. 11798215 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10022189m

Protein [Map View]
TTIEKSGTLLQTFMSSYTNQNGQEEKLGIEEVIDECKTFYFAAKETTGNLLTFVLVLLAMHQEWQNIARGGDIRVLGPTG
IPTLDVLQDLKIIPNLGNLDIPAGTQIYLSVVAMHHDTKTWGNDAEEFNPHIFEDSKKQSTLRVPFGLGPKTCVGQNLAV
NETKTVMATILKHYSFKLSPSYAHAPVLFVTLQPQNDAHLLFTRISS*

DNA
ACAACAATTGAGAAATCAGGAACTCTGCTTCAGACCTTTATGTCTTCTTACACGAATCAGAATGGTCAAGAAGAGAAGCT
TGGAATTGAAGAAGTTATAGATGAGTGCAAGACCTTCTACTTTGCAGCTAAGGAAACAACTGGCAACCTTTTGACGTTTG
TTTTAGTCCTTTTAGCTATGCACCAAGAATGGCAAAACATTGCTCGAGGAGGAGATATACGCGTGCTCGGACCAACCGGG
ATTCCTACTTTAGACGTTTTACAAGACCTCAAGATTATACCTAATCTCGGAAACCTTGACATTCCTGCAGGGACTCAGAT
CTATTTATCAGTGGTCGCGATGCACCACGACACAAAAACATGGGGAAACGACGCAGAAGAGTTTAATCCGCACATATTTG
AAGATTCTAAGAAACAATCAACTCTGCGTGTGCCGTTTGGGTTAGGGCCAAAGACTTGTGTGGGACAGAATCTTGCTGTG
AATGAGACCAAAACTGTTATGGCTACGATCTTGAAGCATTACAGTTTCAAGTTGTCTCCAAGTTATGCTCATGCTCCGGT
TTTGTTTGTGACCTTGCAGCCTCAGAATGATGCTCATCTTCTCTTTACTAGGATTTCCAGTTAA