Details for Capsella Locus Carubv10022149m

Position : scaf_2 ( 5`- 11221445 .. 11223481 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10022149m

Protein [Map View]
MRVSCYRIVVLLSLLNFSLAQYLVLNFSDDIFLSGFDNNSTNAYSDSDGDGFGQSESTSDHEHDPGSWRPIFELDDSSTV
DLTLTRYYSGLQKIISAASEGNTRFMEEGVTELEVFASAGDLHAKSVMGFVYGIGMIREKSEAKSFLQHQLAAEGGNMQS
KMALAYRYIRLDMHDKAAQLYSELAETAFNSFLFCKDYTTFVPIRIHRGPVQDTGMLRKFHGEDSEDFKIIESYAQIGYP
SAMNKTGLFYYFGLRGLRRDHAKGILWFSKALENGELNSMVIMGDIYSRGAGVERNYAKASLYSAFNGLGYLYLKGYGVD
KNYTKAREFFEKVADTEDLSGIYYLGMMYLRGIGVKRDVKQATRYFLVAANGGLPKAIYQMAKMLHVAARINKNLKMLKL
AAALYKTVAESGPWSSMSRWALGAYVKGDVGKAFILYSRMSELGYEVAQSNAAWILDRYGEKSMCMGVSGFCTDKERQER
AHALWLRASKQGNDYAAQLVGELF

DNA
ATGAGAGTATCATGTTACAGGATCGTAGTCTTGTTGTCTCTGCTCAATTTCTCGTTGGCGCAATACTTGGTCCTCAATTT
CTCCGATGACATCTTTCTGAGTGGCTTCGATAATAACAGCACCAACGCATACTCTGACTCTGACGGTGACGGGTTCGGGC
AATCGGAATCAACATCCGACCATGAACATGATCCTGGCTCTTGGCGCCCAATCTTTGAGCTGGACGACTCTTCTACCGTT
GACCTCACGTTGACGCGATACTACTCTGGCCTCCAAAAGATTATCTCGGCGGCTAGCGAAGGAAACACTAGGTTTATGGA
GGAGGGAGTTACCGAGCTAGAAGTGTTTGCATCAGCGGGAGATCTGCACGCAAAATCTGTGATGGGGTTTGTGTATGGGA
TTGGGATGATACGGGAGAAGAGTGAAGCCAAGTCGTTTCTGCAACATCAGTTAGCGGCAGAGGGAGGGAATATGCAATCG
AAGATGGCACTTGCATACAGATATATAAGGCTAGATATGCATGATAAAGCTGCACAGTTATATAGTGAACTAGCAGAGAC
AGCATTCAATAGCTTTCTGTTCTGTAAGGATTACACCACGTTTGTACCAATTAGAATTCATAGAGGACCAGTTCAAGATA
CCGGTATGCTAAGGAAATTCCACGGGGAAGATAGTGAAGATTTCAAGATAATAGAATCCTATGCACAGATTGGTTACCCT
TCAGCAATGAACAAAACTGGTTTATTCTACTACTTTGGTCTGAGAGGATTAAGACGTGATCATGCCAAGGGTATACTCTG
GTTTTCGAAGGCATTAGAGAACGGAGAGCTGAATTCAATGGTAATCATGGGTGATATATACTCCCGAGGAGCTGGTGTTG
AGAGAAATTATGCCAAGGCGTCTCTCTATTCAGCATTTAATGGCCTCGGCTACTTGTATCTCAAAGGCTATGGAGTAGAC
AAAAACTATACTAAGGCAAGAGAATTTTTTGAGAAGGTTGCTGATACTGAAGACCTAAGTGGGATTTATTACCTTGGAAT
GATGTATCTTAGAGGCATTGGAGTCAAAAGAGATGTAAAGCAGGCGACCAGATACTTCCTCGTGGCTGCAAATGGTGGAC
TACCAAAGGCTATTTATCAAATGGCCAAGATGTTACATGTTGCCGCCAGGATCAACAAGAACCTGAAGATGCTGAAATTG
GCTGCGGCTCTTTACAAGACAGTAGCGGAAAGTGGACCATGGAGTTCTATGTCTAGATGGGCTCTTGGAGCTTACGTTAA
AGGTGATGTGGGAAAGGCTTTTATATTGTACTCAAGAATGTCAGAGCTCGGTTACGAAGTAGCACAGAGCAACGCTGCAT
GGATCCTCGATAGATACGGTGAAAAGAGCATGTGCATGGGAGTTTCTGGATTTTGTACGGATAAGGAGAGGCAGGAGCGG
GCTCATGCTTTGTGGTTGCGTGCCTCTAAACAAGGAAACGACTATGCTGCTCAGCTTGTGGGCGAGCTCTTC