Details for Capsella Locus Carubv10022126m

Position : scaf_2 ( 5`- 11721638 .. 11723080 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10022126m

Protein [Map View]
MKRVLSKSLSTLAAGGVNLKPPPPDSGVIANQILSSPTTIDQSLVSIKTTPWTPNLVNSVLKRLWNHGPKALQFFHFLDT
HHRSYVHHASSFDLAIDIAARLHLHPTVWSLLHRMRSLRIGPSPKTFAIVAERFASSGKPDKAVKLFLNMHEHGCFQDLA
SFNTILDVLCKSKRVEKAYELFRALRGRFGADTVTYNVIVNGWCLIKRTPKALEVLKEMVERGIDPNLTTYNTMLKGFFR
AGQIRHAWEFFLEMKKRNCEIDVVTYTTVVHGFGVAGEIKRARNVFDEMIREGVLPSVATYNAMIQVLCKKDCVENAVVM
FEDMVRKGYEPNVTTYNVLIRGLFHAGKFSRGEELMQRMENEGCKPNFQTYNMMIRYYSECSEIDKALCLFGKMGSGDCL
PNLDTYNILISGMFVRKRSEDMVVAGNQAFAKEILRLQSKSGSRLLRKFRL*

DNA
ATGAAGCGTGTTTTGAGCAAATCGTTAAGTACTTTGGCCGCCGGCGGAGTGAATCTTAAACCACCACCGCCAGATTCGGG
CGTTATAGCTAACCAAATCCTCTCTTCTCCCACAACAATTGATCAATCTCTAGTCTCCATCAAAACAACCCCGTGGACTC
CAAATCTCGTCAACTCTGTTCTCAAGCGCCTCTGGAACCACGGTCCTAAAGCTCTCCAATTCTTCCACTTCCTCGACACT
CACCACCGCTCTTACGTCCACCATGCTTCCTCCTTCGACCTCGCCATCGACATCGCCGCCCGTCTTCACCTCCACCCCAC
CGTGTGGTCTCTCCTTCACCGTATGCGCTCTCTCCGCATCGGTCCTTCTCCTAAAACCTTCGCTATCGTCGCCGAGAGGT
TCGCTTCCTCTGGGAAACCTGATAAAGCGGTGAAGCTCTTTCTGAATATGCACGAGCACGGTTGTTTTCAGGATCTGGCT
TCTTTCAATACGATTCTCGATGTCTTGTGTAAATCTAAACGCGTTGAGAAAGCTTATGAGCTGTTTAGGGCTCTTAGGGG
AAGATTTGGTGCTGATACAGTTACTTACAATGTGATTGTCAATGGTTGGTGTTTGATTAAACGTACGCCTAAGGCTTTGG
AGGTTTTGAAAGAGATGGTTGAGAGAGGGATTGACCCTAATTTGACTACTTATAACACAATGCTCAAAGGGTTCTTCCGA
GCTGGGCAGATTAGACATGCTTGGGAGTTCTTCTTGGAGATGAAGAAACGGAATTGTGAAATCGATGTTGTTACTTACAC
TACTGTGGTTCACGGGTTTGGTGTTGCAGGGGAGATAAAGCGGGCTAGGAATGTTTTCGATGAGATGATTAGAGAAGGTG
TGCTTCCTTCTGTTGCGACTTACAATGCTATGATTCAAGTTTTGTGTAAGAAAGATTGCGTAGAAAATGCGGTTGTCATG
TTTGAGGACATGGTGAGGAAAGGTTATGAACCGAATGTGACGACTTATAATGTGTTGATAAGAGGCTTGTTTCACGCTGG
AAAGTTCAGTCGTGGAGAGGAGTTGATGCAGAGAATGGAGAATGAAGGCTGCAAACCAAACTTCCAGACATACAATATGA
TGATACGCTATTATTCAGAATGCAGCGAGATTGACAAAGCCTTGTGTTTGTTTGGGAAGATGGGGAGTGGAGATTGCTTG
CCAAACCTGGATACTTATAACATACTGATAAGTGGAATGTTTGTGAGAAAAAGATCAGAAGATATGGTGGTCGCTGGGAA
TCAAGCTTTCGCAAAGGAGATCTTGAGATTGCAGAGTAAATCTGGTAGCCGGCTTCTCCGGAAGTTCAGGTTATGA