Details for Capsella Locus Carubv10022016m

Position : scaf_2 ( 5`- 11698186 .. 11698851 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10022016m

Protein [Map View]
MDHISQISRVFILLASLITLFTNPTLSSINRNPLQDFCVADLQASPTNSGYPCKAQVTSEDFFYSGLNTPLNTSNPKGTA
ANSANLMTFPGLNTMGISMYNVEIAPGGYNPPHSHPGATEAGVVIEGSVLVGFLTTNYTLFQKVIGPGDMFVIPPGLIHY
EGNVGKTQSRLLTVVADDLPSEVVLPNTLFATKPAIPNAVLMKAFKADSKTINMLRSKFTS*

DNA
ATGGATCACATTTCACAAATCTCGCGAGTTTTCATCCTCCTTGCATCCCTCATTACTCTCTTCACGAACCCTACTCTCTC
ATCCATAAACCGTAACCCCTTACAAGACTTCTGTGTAGCTGATCTCCAAGCTTCCCCAACCAACAGTGGCTACCCCTGCA
AAGCACAAGTCACCTCTGAAGACTTCTTCTACTCCGGCTTGAACACTCCTTTAAACACCTCGAACCCAAAAGGTACTGCC
GCTAACTCAGCCAACCTCATGACCTTTCCAGGCCTAAACACTATGGGAATATCCATGTACAACGTTGAAATAGCGCCTGG
AGGATACAACCCACCTCACTCGCACCCCGGTGCTACCGAGGCAGGGGTCGTGATCGAAGGCTCGGTCTTGGTTGGGTTCT
TGACGACTAACTACACGTTGTTCCAGAAGGTTATTGGACCCGGTGATATGTTTGTGATTCCTCCGGGACTCATCCATTAC
GAGGGGAATGTTGGGAAAACTCAATCGCGTCTCTTGACGGTGGTTGCTGACGACTTGCCTAGTGAGGTTGTTCTGCCTAA
CACTCTGTTTGCTACCAAACCTGCGATCCCAAACGCAGTGTTGATGAAGGCGTTCAAAGCAGATAGTAAAACAATCAACA
TGCTCAGGTCAAAGTTTACTAGTTAA