Details for Capsella Locus Carubv10021919m

Position : scaf_2 ( 5`- 11674073 .. 11679540 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10021919m

Protein [Map View]
MGGGRIHSLPPENASVSASAVAIGNTKLSDAPVLFFVYFHKAFRAQLVELRRFATDAAEANNSSRDLAVELSRKFEFLKL
VYKYHSAAEDEVIFSALDARVKNIVSNYSLEHAGTDDLFTSVFHWLHVLEEEIGSTSDVLRQVIICIGTIQSSICQHMLK
EELQVFPLLIEKFSFKEQASLVWQFICSVPVMVLEDFLPWMMSYLSHEEKTEVENCIKDVVPIEDSLQQVIRSWLLDDKG
QSCGGIPTEIMKGVHYVDVSKNMKKLPQTHESSGCFQRFWQWSKKSLHIPNVGGHSPIHGLHLFQNAIEKDLRDIREGLS
QAKFPSLSLDLDVLMARLNFLADVLVSYSNAFKRFLHPVLEEMTDRRSSNTAQFTIDGCLENFQRLLYKSADDKSRTANF
LFQLQEELENLIVQVTKQFSLQRTKVFPFITKNCNHEMQKQLLYTSIHVLPLGLLKCVILWFSAHLSEEESQSILQFLSL
EDFSSKKSFACLLLQWLRFGYSGKTSVESFWKQLAVMFKVRCSCQKENNTKEASGSFSDQAQLELCKGSKDDLLVCPWKK
NKSSTCLLSRDLGAGDMYETPYSSRMNQQMIFSGKHKPPLHLPEFFGEKNMDDPLIMNVKPIDLLFFFHKAMKMDLDYLV
CGSARLAADFCFLTEFQQRFQMIKFLYQIHSDAEDEIAFPALEAKGRLRNISHSFSIDHELETKHFDKVSFILNEMSELN
MLVSTINPRAADHRKMKYERLCLSLQEIGKSMHKLLSEHIQHEETELWGLFRNCFAIEEQEKIIGCMLGRISGEILQDMI
PWLMESLSSDEQLAAMSLWRQVTRKTMFVEWLTEWYNGHVIQDEVGEANNDPFEDSDPLEIVWKYLFETNADGDRGSIGS
YLVELPETYLTGNMNKSPSDNNVEVGNKEKKDLECSESKKICRGADKMEDNEKTDINYQTRSPAQTFRMSQKVSRFGQSK
KYEQLLTISEEELVAVIKKISCDSSMDPRKKSYIKQNLLMSRWNISQRAYSLEPSSLLSDMETVPGQHPSYRDPHSLIFG
CNHYKRNCKLLAPCCDKLFTCIRCHDEEADHSVDRKQITKMMCMKCLLIQPIGANCSNTSCKSSMGKYFCKICKLYDDER
KIYHCPYCNLCRVGKGLGIDYFHCMKCNACMSRTLAEHVCREKCLEDNCPICHEYIFTSNSPVKALPCGHLMHSSCFQEY
TCSHYTCPICSKSLGDMQVYFKMLDALLAEEKMPDEYSNKTQIILCNDCGRKGNVPYHWLYHKCTTCGSYNSRLL*

DNA
ATGGGAGGCGGACGTATTCATTCCCTTCCGCCGGAGAATGCTTCGGTTTCTGCTTCTGCGGTTGCCATCGGAAACACGAA
GCTTTCGGATGCTCCAGTTCTTTTCTTTGTATACTTCCACAAGGCTTTCCGTGCTCAGCTGGTTGAGCTCCGGCGTTTCG
CTACTGACGCCGCAGAAGCTAATAATTCTAGCCGGGATCTGGCGGTGGAGCTCTCCCGGAAGTTTGAGTTTTTGAAGCTT
GTATATAAGTATCACAGCGCAGCTGAAGATGAGGTTATCTTTTCGGCGCTTGATGCACGAGTGAAAAACATAGTTTCTAA
TTATTCGCTTGAGCATGCTGGCACAGATGATCTCTTCACCTCAGTTTTTCATTGGCTACATGTTCTTGAAGAGGAAATAG
GAAGCACAAGTGATGTACTTCGTCAAGTTATAATATGCATAGGCACCATTCAGTCATCTATATGCCAACATATGCTTAAA
GAAGAGCTGCAGGTCTTTCCTTTGTTAATTGAGAAGTTCTCTTTCAAAGAGCAGGCATCACTTGTGTGGCAATTCATTTG
TAGTGTTCCAGTGATGGTACTGGAAGACTTTTTGCCCTGGATGATGTCTTATCTCTCTCACGAGGAGAAAACTGAAGTTG
AGAATTGCATCAAAGATGTTGTCCCCATCGAAGACTCATTACAACAGGTCATACGCTCTTGGCTACTTGATGACAAGGGC
CAATCTTGTGGTGGGATTCCTACAGAGATCATGAAAGGAGTCCACTATGTAGACGTGTCTAAGAATATGAAGAAGTTACC
TCAGACACATGAGTCCAGTGGATGTTTTCAACGCTTTTGGCAGTGGAGTAAAAAGTCCCTTCATATTCCAAATGTAGGAG
GACACAGCCCGATTCATGGTCTTCATCTTTTTCAAAATGCTATCGAAAAAGATTTGAGAGACATTCGGGAAGGATTAAGC
CAAGCAAAATTCCCAAGCCTTAGTTTAGACCTTGACGTACTGATGGCTCGATTAAACTTCCTTGCTGATGTCCTTGTTTC
TTATAGCAATGCATTCAAAAGGTTCCTTCACCCGGTGTTGGAAGAAATGACAGATCGCCGCTCTTCAAATACCGCACAAT
TCACCATAGATGGCTGTCTCGAGAATTTTCAGAGATTACTATACAAAAGTGCTGATGATAAATCAAGGACGGCTAATTTT
CTGTTTCAGCTCCAAGAGGAACTTGAGAACCTTATAGTCCAAGTAACCAAGCAATTTTCTTTACAGAGAACCAAGGTATT
CCCATTCATCACCAAGAATTGCAACCATGAAATGCAGAAGCAGCTCCTATACACAAGCATTCATGTCTTACCTCTTGGAT
TGCTAAAGTGTGTTATACTTTGGTTTTCTGCTCACTTGTCAGAAGAGGAATCTCAATCCATTCTTCAGTTCTTAAGTTTG
GAAGATTTTTCTTCCAAAAAATCATTTGCATGCCTCTTGTTGCAGTGGCTTCGCTTTGGTTACTCAGGCAAAACATCTGT
TGAAAGTTTTTGGAAACAACTGGCTGTAATGTTTAAAGTAAGATGCTCCTGCCAAAAGGAGAACAACACTAAAGAAGCAT
CTGGATCATTTTCCGACCAAGCACAGCTGGAACTGTGCAAAGGATCTAAAGATGATTTGCTTGTTTGTCCTTGGAAGAAA
AACAAGTCTTCAACCTGCTTACTGTCAAGGGATTTAGGCGCTGGAGATATGTACGAGACACCTTACTCAAGTCGAATGAA
TCAGCAAATGATTTTCTCAGGGAAACATAAGCCTCCACTCCATCTTCCAGAGTTTTTTGGTGAGAAGAATATGGATGATC
CACTTATTATGAACGTTAAACCAATTGACCTCCTTTTCTTCTTCCATAAGGCAATGAAGATGGATTTGGACTACCTTGTT
TGTGGATCAGCAAGATTGGCAGCCGACTTTTGTTTTCTCACTGAGTTTCAACAGCGATTCCAGATGATAAAGTTTTTGTA
TCAGATACATTCTGATGCAGAGGATGAGATTGCATTTCCAGCATTGGAGGCCAAGGGACGACTTAGAAACATTAGTCACT
CATTTAGCATTGATCATGAGCTAGAAACTAAACACTTCGATAAAGTTTCATTCATATTGAATGAGATGTCAGAGCTGAAC
ATGTTAGTTTCTACTATCAATCCCAGAGCAGCAGACCACCGAAAGATGAAGTATGAGCGGTTGTGTTTGAGTCTCCAAGA
GATTGGCAAATCTATGCACAAGCTATTGTCTGAGCATATCCAGCATGAAGAAACTGAACTCTGGGGTCTATTCAGGAACT
GTTTTGCTATTGAAGAGCAAGAAAAAATCATAGGATGCATGCTTGGGAGAATAAGTGGGGAAATATTGCAGGATATGATA
CCCTGGTTAATGGAATCTTTATCCTCTGATGAACAGCTTGCAGCGATGTCCTTATGGCGCCAAGTAACAAGGAAAACAAT
GTTTGTCGAATGGCTAACAGAATGGTATAACGGTCATGTTATACAAGATGAAGTCGGAGAAGCAAACAATGATCCATTTG
AGGATTCAGATCCATTGGAGATTGTCTGGAAGTATCTCTTTGAAACAAATGCTGATGGGGATAGAGGGAGCATTGGAAGC
TACCTTGTCGAACTTCCAGAGACATACTTGACAGGTAATATGAATAAGTCACCTTCTGATAACAATGTCGAGGTTGGAAA
CAAAGAGAAAAAAGATCTGGAATGCTCAGAAAGTAAGAAGATATGTAGAGGAGCTGACAAAATGGAGGACAACGAAAAAA
CTGACATCAATTACCAGACAAGAAGTCCTGCTCAGACTTTCCGAATGTCTCAGAAGGTTAGTCGGTTTGGTCAATCCAAG
AAATATGAACAACTGTTAACAATAAGTGAAGAAGAACTGGTGGCTGTGATTAAGAAAATATCATGCGACTCTTCCATGGA
TCCTCGGAAGAAATCTTATATCAAGCAGAACTTGTTAATGAGTCGGTGGAATATCTCACAACGGGCATACAGTCTGGAAC
CATCCTCTCTCTTAAGCGACATGGAAACAGTTCCTGGTCAACATCCATCATATCGAGATCCTCACAGTTTGATTTTCGGC
TGCAATCACTACAAGAGGAATTGCAAGCTTCTTGCTCCTTGTTGCGACAAACTCTTCACATGTATACGATGTCATGATGA
AGAGGCTGATCACTCAGTAGATAGGAAACAGATAACAAAGATGATGTGCATGAAATGCCTCTTGATTCAGCCAATTGGTG
CAAATTGCTCAAATACTTCGTGCAAGTCGTCAATGGGAAAATACTTCTGCAAAATATGCAAATTATATGACGATGAAAGG
AAAATTTATCACTGTCCTTACTGCAATCTCTGCCGAGTTGGGAAAGGATTGGGAATTGACTACTTCCATTGCATGAAATG
CAATGCCTGCATGTCGCGTACCTTAGCAGAGCATGTTTGCAGGGAAAAGTGTTTAGAAGATAATTGTCCTATTTGCCATG
AGTACATTTTTACCTCCAACTCCCCAGTCAAGGCTCTTCCTTGCGGGCACTTGATGCACTCCTCATGCTTTCAGGAGTAC
ACATGTTCCCACTACACATGCCCTATCTGCAGCAAGTCGCTAGGAGATATGCAGGTCTATTTTAAGATGCTAGACGCATT
ACTTGCAGAAGAGAAGATGCCTGATGAATACTCCAACAAAACTCAGATAATACTGTGTAATGACTGTGGAAGAAAAGGAA
ATGTTCCTTATCATTGGCTCTACCACAAATGCACAACCTGTGGCTCCTACAATTCGAGGCTCCTTTAG