Details for Capsella Locus Carubv10021916m

Position : scaf_2 ( 5`- 11256019 .. 11257705 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10021916m

Protein [Map View]
MGTVLDSHFLALTAIVTVVYQFIFFVITALFKFDQVTDFAGTTIFSPLFPFAQICCSPSFSVTILQWGEDRRFDEQRGNL
VRLIIFWTLQSPFGSHACDLKLEFLFPFHDVIGWTMWVFGFLIEAAADQQKLSFKNSPENRGKWCDVGVWKYSRHPNYFG
ELICFYLRSIFSPLILLPRGVYGNLPGWCKTIFLFEFPFYNRNLPQEVAV*

DNA
ATGGGAACAGTTCTGGATTCGCATTTCCTGGCCCTCACTGCCATTGTCACTGTGGTTTACCAGTTCATATTCTTCGTAAT
CACAGCTCTTTTCAAATTTGATCAAGTCACTGACTTTGCTGGTACGACCATTTTCAGTCCTTTATTCCCATTTGCTCAAA
TATGTTGTTCCCCTTCATTCTCTGTTACGATCTTGCAATGGGGTGAAGATCGACGCTTTGATGAACAGCGTGGAAATTTA
GTGAGACTAATAATTTTCTGGACTCTTCAGAGCCCCTTTGGAAGTCATGCTTGTGATCTCAAACTAGAGTTCTTGTTTCC
CTTTCATGATGTTATCGGTTGGACAATGTGGGTTTTTGGTTTCTTGATTGAAGCTGCAGCTGATCAACAGAAGCTCTCTT
TTAAAAACTCTCCAGAAAACAGAGGAAAATGGTGTGATGTTGGAGTGTGGAAGTACTCAAGACATCCAAACTACTTCGGA
GAGCTAATTTGTTTCTATCTTCGATCAATCTTTAGCCCTCTGATACTGTTGCCGAGAGGAGTTTATGGGAACTTACCTGG
ATGGTGCAAGACGATCTTTCTCTTCGAGTTTCCGTTTTACAACCGAAATCTCCCTCAAGAGGTGGCTGTTTAG