Details for Capsella Locus Carubv10021822m

Position : scaf_2 ( 5`- 11217641 .. 11218241 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10021822m

Protein [Map View]
MGITRIFGVVVTIVITLFSVQVTAQIIEEAQEAMRCVTKLLPCGPYIHLSIPPPPWCCTPMKEIAENNSTCLCAAFNHPE
MLRFIALTKESALNLLSSCGVPYDLSLCTTNPSSPSALPEAASNGMHAFTFSFFFFGLMLLSNQKLYFGLCAIF*

DNA
ATGGGTATTACAAGAATCTTCGGCGTAGTAGTCACCATCGTCATCACACTCTTCTCCGTTCAAGTAACAGCGCAAATCAT
CGAAGAAGCTCAAGAGGCAATGCGATGCGTGACAAAACTGTTGCCGTGTGGACCGTACATCCACTTGTCGATTCCTCCGC
CGCCGTGGTGTTGCACTCCGATGAAAGAGATAGCCGAGAACAACTCGACGTGTCTATGCGCCGCTTTCAACCATCCGGAA
ATGCTCAGATTCATTGCTCTCACCAAAGAGTCCGCTCTTAATCTCCTTAGTTCATGTGGTGTTCCTTATGATTTGTCACT
CTGCACCACCAATCCTTCTTCGCCATCTGCGTTGCCGGAAGCTGCGAGCAACGGTATGCATGCATTTACTTTCTCTTTTT
TTTTTTTTGGTTTAATGTTGCTTTCTAATCAAAAATTATATTTTGGATTATGTGCTATTTTTTAA