Details for Capsella Locus Carubv10021634m

Position : scaf_2 ( 5`- 11715382 .. 11716033 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10021634m

Protein [Map View]
SSLSEIRNLRLVSKPFQRICNDPNILQSLSLHEIPLFPCYENKRNRGLKHIAKAADKGNQEAQYIYGLILICLGGETKEK
GFKVLSSLRKPLMSNDMWWCGEPMMRHLKRSYVRENCSCDGRTDMFFVKNCGRDRYGEDNDMTTSSACEICLWHHEVQLF
FDKIEK*

DNA
TCATCTTTATCCGAGATTCGAAATCTTCGATTAGTTTCGAAACCGTTTCAACGTATCTGCAACGATCCAAACATTCTGCA
GAGCCTTTCCCTCCATGAGATCCCTCTGTTTCCATGTTATGAAAATAAACGAAACAGAGGACTCAAACATATAGCAAAAG
CTGCAGACAAGGGAAATCAAGAAGCACAATATATTTATGGATTGATCCTTATTTGTCTTGGGGGCGAAACAAAAGAAAAG
GGTTTTAAGGTGTTGTCTTCTTTAAGAAAGCCTTTGATGTCAAATGACATGTGGTGGTGTGGTGAACCGATGATGAGACA
TCTTAAAAGGAGCTATGTTCGTGAGAATTGCAGTTGTGATGGTCGAACGGACATGTTCTTTGTAAAGAATTGTGGTAGGG
ATCGTTATGGTGAGGATAACGACATGACTACTTCATCCGCTTGTGAGATTTGTTTGTGGCATCATGAAGTCCAACTCTTC
TTTGATAAGATTGAAAAATGA