Details for Capsella Locus Carubv10021612m

Position : scaf_2 ( 5`- 11792038 .. 11793646 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10021612m

Protein [Map View]
MAGRRDRIQQHRGYRITIAIVVGILIGCVCAFVFPNGFFNSGSSLLVNERLSKSNSKVGLASCESSERVKMLKSEFSVVS
VKNAELKKQVKELTEKVRLAEQETENARNQVLVLGSQIKAGPFGTVKSLRTNPTVVPDESVNPRLAKLLEKVAVSKEIIV
VLANSNVKPMLEVQITSVKRVGIQNYLIVALDDSIVDFCKSKEVAYYKRDPDKAVDMVGKSGGNHAVSRLKFRVLREFLQ
LGYGVLLSDVDIVFLQNPFGHLYRDSDVESMSDGHDNNTAYGFNHVFDDPSMGWSRSAHTMRIWVFNSGFFYLRPTLPSI
DLLDRVADTISKTGEWDQAVFNEQLFYPSHPGYTGLHASKRVMDMYEFMNSKVLFKTVRKNEELKKLKPVIVHLNYHPDK
LERMQAVVEFYVDGKQDALDSFPDGSF*

DNA
ATGGCGGGTCGTAGAGACAGAATCCAACAGCACCGTGGATATCGAATTACAATCGCCATCGTTGTCGGAATTCTTATCGG
CTGTGTCTGTGCCTTCGTGTTCCCCAACGGGTTCTTTAACTCGGGGTCATCGTTGCTAGTTAACGAACGTCTTTCGAAAT
CGAACTCTAAGGTTGGATTGGCTTCATGTGAATCGTCTGAACGTGTCAAAATGCTCAAATCAGAATTTTCAGTCGTCTCG
GTAAAGAACGCAGAGTTGAAGAAGCAGGTCAAGGAGCTAACAGAAAAGGTACGGTTGGCTGAACAAGAAACAGAGAATGC
AAGGAATCAAGTTTTGGTTTTGGGATCACAAATCAAGGCAGGGCCTTTTGGCACTGTCAAGAGTTTGAGAACTAATCCAA
CTGTAGTTCCCGACGAGTCTGTTAACCCCAGGTTAGCTAAGCTTTTAGAGAAGGTAGCTGTTAGTAAAGAGATCATTGTG
GTTCTTGCAAATTCAAATGTGAAACCAATGTTGGAGGTGCAGATTACTAGCGTCAAGAGAGTTGGTATCCAGAACTACCT
CATTGTCGCGTTGGATGATTCTATAGTAGATTTCTGTAAATCAAAGGAGGTTGCATATTACAAGAGAGATCCAGATAAAG
CCGTGGACATGGTTGGGAAAAGCGGAGGTAACCACGCTGTTTCCAGGCTGAAGTTCCGCGTCTTAAGAGAGTTCTTGCAG
CTCGGTTATGGAGTTCTTCTATCGGATGTGGACATTGTCTTTTTGCAGAACCCTTTTGGTCATCTGTACAGAGACTCTGA
TGTGGAGTCTATGAGCGATGGCCATGACAATAACACGGCTTACGGCTTCAACCATGTGTTTGATGACCCATCCATGGGAT
GGTCTAGGTCTGCTCACACAATGAGGATATGGGTATTCAATTCCGGGTTTTTCTATCTAAGACCAACTCTTCCTTCGATC
GACCTACTCGATCGTGTGGCAGATACAATCTCTAAGACAGGGGAATGGGACCAAGCTGTTTTCAATGAACAACTGTTTTA
CCCTTCGCATCCCGGATACACTGGCTTACACGCTTCCAAAAGAGTCATGGATATGTACGAATTCATGAACAGTAAAGTCC
TGTTCAAAACGGTGAGAAAGAATGAGGAACTAAAGAAGTTGAAGCCAGTGATTGTTCACCTGAATTACCATCCGGATAAA
CTCGAACGAATGCAAGCAGTGGTGGAGTTCTACGTTGATGGCAAGCAAGATGCGCTTGATAGCTTCCCAGATGGTTCTTT
CTAG