Details for Capsella Locus Carubv10021534m

Position : scaf_2 ( 5`- 11258008 .. 11259252 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10021534m

Protein [Map View]
MATLFTATVPSHHRFVSPSQHPKQSLPSQSLSVTLMRNPEPAAAFTLQEQQLTDWMASPVTRRFGIGAGLTWSGFLAFGV
VSEQMKKSPLDVFQEEDSTRGLEKQEEIILPNGIRYYDLQAGSGATPSSGYLVVFDVKGQVYGTEQVFVDTFGSKDKKKS
LAMVMDSRPYSKGVCEGIEYVLRSMKAGGKRRVIIPPSLGFGNKNVDFGPGLQIPPSATLDYIIEVDTVYCFQTIV*

DNA
ATGGCGACTCTCTTCACTGCGACGGTTCCTTCTCACCACCGTTTTGTCTCACCTTCTCAACACCCGAAACAGAGCCTTCC
ATCGCAGTCGCTAAGCGTTACTTTAATGCGGAATCCGGAACCCGCGGCGGCGTTCACATTGCAGGAACAGCAGTTGACGG
ATTGGATGGCTTCTCCGGTGACGCGACGGTTCGGAATCGGTGCCGGATTAACCTGGTCTGGGTTTCTAGCTTTTGGTGTT
GTCTCTGAGCAGATGAAGAAGTCACCACTCGATGTGTTCCAGGAAGAAGATAGCACAAGAGGTTTAGAAAAGCAAGAAGA
GATCATCTTACCAAACGGCATAAGGTACTATGATCTACAAGCCGGAAGTGGAGCTACTCCAAGCTCAGGATACTTGGTAG
TGTTTGATGTAAAGGGACAAGTATATGGAACCGAACAAGTGTTTGTGGACACATTTGGAAGCAAAGACAAGAAGAAGTCA
CTAGCGATGGTAATGGACTCAAGACCATATAGCAAAGGAGTATGCGAAGGCATAGAGTACGTTCTGAGGTCAATGAAGGC
TGGTGGAAAACGTAGAGTGATCATCCCACCATCCTTAGGATTTGGAAACAAGAATGTTGATTTTGGACCGGGTTTGCAGA
TTCCTCCATCTGCAACACTTGACTATATCATCGAGGTTGATACAGTTTATTGTTTCCAAACTATTGTATGA