Details for Capsella Locus Carubv10021419m

Position : scaf_2 ( 5`- 11802832 .. 11804721 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10021419m

Protein [Map View]
MADSRKGKPFFFCFSFFVSLSLLFLLPSFPDASTAVTASESDPILSERTDASPGVVTISESDSQSVSLHRLEELVRNLTE
VVARLDAKLSEAPFKVKKEISRDEIEEEGVREKAKAFSVTKYSPFWSERFEFTSAVKLDSDATCINVLPFRDYQGLSKYF
AVGDASGRVFVFLRNGDVLVEFFTTCDSPITAMVSYMSVYKNESFVVTGHQSGVILLHRLREGSIGEDWSSAVMENIGKF
DGTDDGLQVTLLEVHHVGRVRYILATDLSGKLTVFTENRTVYGSVTPSSRPLVFLKQRLLFLTETGAGSLDLRSMKIKES
ECEGLNHSLARSYVFDASERSKAYGFTSEGEIIHVLLLGDIMNFKCRVRSKKKVQMEDPVALQAIKGYLLVVNQEKVFVY
NVSTQHYVRTTGPRLLFPAALEDIRSTFLSHRESSKTTYHQKLEKATPLIASDREKLLVMGLGDGYVATYKSKLPIFKAE
FNTMLWSSPVFFFILFLFGAWHFFAKKKESLTAWGPDDPFASTTMSSSSTTTAQNSSAFAEPIRRNDDHMDLRRRYVSPS
RYPPGPATGAYRSVGSNDPSSRAPVETTNYRTTAQEMKYRGGSGLDSAGFGKRRESLFGNNNKASDDES*

DNA
ATGGCGGATTCTCGAAAAGGCAAGCCCTTTTTCTTCTGCTTCTCCTTCTTTGTTTCGCTTAGTTTGCTTTTCCTTTTGCC
GTCTTTTCCGGATGCATCTACTGCTGTCACCGCTTCCGAGTCCGATCCGATTTTGTCAGAGAGAACAGATGCTTCTCCCG
GAGTTGTGACCATCAGCGAATCCGATAGTCAAAGTGTTTCGTTGCATAGACTCGAGGAACTTGTTAGGAATCTTACGGAA
GTAGTTGCTAGGTTAGATGCCAAATTATCTGAAGCTCCGTTTAAGGTAAAGAAGGAGATCAGTCGTGATGAGATCGAAGA
AGAAGGGGTTAGAGAGAAAGCCAAGGCTTTTTCCGTGACAAAATACAGTCCTTTCTGGTCTGAGAGATTCGAATTCACAT
CAGCTGTGAAATTAGACTCCGACGCGACTTGTATCAACGTGTTGCCGTTTCGAGATTACCAAGGTTTAAGCAAGTATTTC
GCAGTTGGGGATGCAAGTGGTAGGGTTTTTGTGTTCTTGAGAAATGGGGATGTTTTGGTTGAGTTTTTCACTACCTGCGA
TTCACCAATCACGGCAATGGTGTCATACATGTCTGTGTATAAGAACGAGAGCTTCGTAGTGACGGGTCACCAGAGCGGAG
TCATCTTGTTGCATAGACTCCGCGAGGGCTCTATCGGGGAAGATTGGAGTTCAGCTGTGATGGAAAATATTGGCAAATTT
GATGGCACGGATGACGGATTGCAAGTGACTCTATTGGAAGTGCATCATGTGGGTCGGGTTAGGTATATATTGGCTACGGA
TCTTAGCGGAAAGCTCACTGTTTTCACTGAGAACAGAACTGTTTATGGCTCCGTTACCCCATCTAGTAGACCGCTTGTGT
TCTTGAAGCAGAGGCTGTTGTTTCTCACTGAGACTGGTGCTGGTTCATTGGACTTAAGAAGCATGAAGATCAAAGAATCC
GAGTGTGAAGGTTTGAACCATTCTCTAGCGAGAAGTTATGTTTTTGATGCGTCAGAACGGTCTAAAGCTTACGGATTCAC
ATCCGAAGGCGAAATCATTCACGTATTGCTCCTAGGAGACATCATGAACTTCAAATGTAGAGTGAGATCAAAGAAAAAGG
TTCAAATGGAGGATCCTGTAGCGTTGCAAGCCATCAAAGGCTATCTACTTGTAGTCAACCAAGAGAAAGTCTTTGTATAC
AATGTGTCGACTCAACACTATGTTCGAACCACGGGTCCTCGGCTTCTTTTTCCCGCTGCATTGGAAGACATCAGGTCAAC
ATTCTTGAGCCATCGAGAATCATCGAAAACCACCTATCACCAGAAGCTCGAAAAGGCAACTCCGTTGATAGCAAGCGACC
GTGAAAAGCTGCTTGTGATGGGTTTAGGAGATGGATACGTCGCGACATACAAATCAAAGCTTCCAATCTTCAAAGCGGAA
TTCAACACGATGCTTTGGAGCAGTCCTGTCTTCTTCTTCATACTTTTCTTATTTGGCGCTTGGCATTTTTTTGCCAAGAA
GAAAGAATCTCTCACAGCTTGGGGACCTGACGATCCTTTCGCCTCAACAACAATGTCTTCTTCTTCTACTACAACTGCAC
AAAACAGTTCCGCATTCGCTGAACCAATCAGGAGAAACGACGACCACATGGATCTTCGAAGAAGGTATGTTTCGCCATCT
CGGTATCCTCCTGGACCAGCAACAGGAGCTTACCGTTCAGTGGGTTCTAACGACCCGAGCTCAAGAGCTCCAGTGGAAAC
AACTAACTACAGAACAACCGCACAGGAAATGAAGTATCGTGGTGGGTCAGGTCTTGATTCAGCTGGGTTTGGTAAAAGAA
GAGAGAGCTTGTTTGGTAACAACAACAAAGCTTCAGACGACGAAAGTTAG