Details for Capsella Locus Carubv10021157m

Position : scaf_2 ( 5`- 11846694 .. 11847882 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10021157m

Protein [Map View]
QLSSLTLSLFFLSFSFPSQVRKQMASNSTSSTSSWTFHQNKMFERALAIYDKDTPDRWHNVAKAVEGKSVEEVKHHYDIL
VEDLINIESGRVPLPKYKTMESKPRGTSDFDTRVMKKNLKI*

DNA
CAACTCTCATCACTTACTCTCTCTCTCTTTTTTCTATCTTTTTCCTTTCCCTCTCAAGTTAGAAAACAAATGGCGTCAAA
CTCTACAAGTTCGACCTCTTCATGGACGTTCCATCAGAACAAGATGTTCGAGAGGGCCTTGGCAATTTACGACAAGGACA
CACCCGACCGTTGGCACAATGTGGCGAAAGCTGTCGAAGGGAAATCTGTAGAGGAAGTGAAGCATCACTATGACATTCTC
GTCGAGGATCTCATCAACATCGAGTCTGGTCGTGTCCCTTTGCCCAAATACAAGACCATGGAATCTAAACCAAGAGGCAC
CAGCGACTTCGACACAAGGGTGATGAAGAAGAATTTGAAGATCTAA