Details for Capsella Locus Carubv10021066m

Position : scaf_2 ( 5`- 11251776 .. 11252599 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10021066m

Protein [Map View]
MANTTPETTNKSTTPSTDLELKKVFDQFDANGDGKISVSELGNVFKSMGTSYTEEELNRVLDDIDIDRDGYINQEEFATI
CRSSSSAAEIREAFDLYDQDKNGLISSSEIHKVLNRLGMSCSVEDCVRMIGHVDADGDGNVNFEEFQKMMSSPELVKGSS
AN*

DNA
ATGGCGAACACAACTCCCGAAACCACCAACAAATCCACAACACCGTCGACGGACTTGGAGCTCAAGAAGGTCTTCGACCA
ATTCGATGCCAACGGCGACGGGAAGATCTCCGTTTCGGAGCTCGGCAACGTTTTCAAATCCATGGGAACGTCATACACGG
AAGAAGAGCTTAACCGCGTTCTAGACGATATCGACATCGATCGCGACGGTTACATCAACCAGGAAGAGTTCGCCACCATC
TGCCGATCATCCTCCTCCGCCGCAGAGATCCGCGAGGCTTTTGATCTATACGACCAGGACAAGAACGGTTTGATCTCGTC
GTCTGAGATCCATAAGGTTCTCAACCGTCTTGGTATGTCTTGCTCTGTTGAAGACTGTGTGAGAATGATCGGGCATGTTG
ATGCTGATGGCGATGGCAATGTTAATTTTGAGGAGTTCCAGAAAATGATGTCTTCGCCTGAGCTCGTTAAGGGATCCTCC
GCCAATTAG