Details for Capsella Locus Carubv10020988m

Position : scaf_2 ( 5`- 11717483 .. 11719031 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10020988m

Protein [Map View]
FGDVCFRPLRLGDHCGLIPNSKEHRKFSWWSPMAFSATLSQLSSLSTISSSLPFSSRRFPLRSLPQFSVKAEAEKEKQST
QAKSEGEASPAAATKTPKTLPKKPVYSMKKGQIVRVDKEKYLNSINYLSVGHPPFYKGLDYIYEDRGEVLDLRVFETGEY
ALVGWVGIPTAPAWLPTDMLIKSEKLVYERM*

DNA
TTCGGTGATGTCTGTTTTAGACCGTTGAGACTTGGAGACCATTGCGGTCTTATCCCAAACTCCAAAGAACACAGAAAATT
TTCTTGGTGGTCTCCAATGGCTTTCTCAGCGACTCTGTCTCAGCTTTCCTCTCTCTCTACCATCTCCTCTTCATTACCAT
TTTCTTCTAGAAGATTCCCTCTTCGATCTCTACCTCAATTCTCAGTCAAAGCAGAAGCAGAGAAAGAGAAACAGAGCACA
CAGGCCAAGTCGGAAGGGGAAGCATCACCAGCTGCTGCAACCAAAACCCCTAAAACGCTTCCCAAGAAACCGGTTTACTC
GATGAAAAAGGGTCAAATCGTTCGTGTGGACAAAGAGAAGTACCTCAACAGCATCAATTACTTATCAGTTGGACATCCTC
CTTTTTACAAAGGACTTGATTACATCTATGAAGACCGGGGTGAGGTCTTGGACCTTCGTGTTTTTGAGACAGGGGAGTAT
GCACTTGTTGGATGGGTTGGTATCCCGACTGCACCAGCTTGGCTACCAACAGATATGTTAATCAAGTCTGAGAAACTTGT
TTACGAGCGAATGTAA