Details for Capsella Locus Carubv10020944m

Position : scaf_2 ( 5`- 11852816 .. 11854009 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10020944m

Protein [Map View]
MALDICVKVAVGAPDVLGDCPFSQRVLLTLEEKELPYKIHLINVSEKPQWFLDISPEGKVPLMKLDGKWVADSDVIVGLL
EEKFPEPSLKTPPEFASVGSKIFGAFVTFLKSKDANDGSEKALVDELEALDNHLKTHSGPFVAGEKVTAVDLSLAPKLYH
LEVALGHYKKWSVPESLTNVRNYANALFARESFEKTKAKNEFVVAGWESKVNA*

DNA
ATGGCTCTCGATATCTGCGTCAAGGTTGCCGTCGGGGCTCCTGATGTTCTCGGAGACTGCCCGTTTAGCCAACGTGTTCT
TCTGACCCTCGAGGAGAAGGAGCTTCCCTACAAGATCCATCTGATTAACGTCTCCGAAAAACCCCAGTGGTTCTTAGACA
TTAGCCCAGAGGGGAAAGTTCCGCTGATGAAGCTTGACGGCAAATGGGTGGCTGATTCTGACGTTATCGTTGGACTTCTT
GAGGAGAAATTTCCTGAGCCTTCTCTCAAGACTCCTCCTGAATTTGCCTCTGTGGGATCCAAAATCTTTGGTGCTTTTGT
GACTTTCTTGAAGAGCAAAGATGCCAATGACGGATCCGAGAAGGCCTTGGTCGATGAGTTAGAAGCCTTGGATAATCACT
TGAAGACACATTCTGGTCCTTTTGTAGCCGGAGAGAAAGTTACTGCTGTGGATCTGAGTTTAGCACCTAAGCTTTACCAT
CTTGAGGTTGCTCTTGGTCATTACAAGAAATGGTCTGTCCCTGAGAGCTTGACTAATGTTCGTAACTACGCCAATGCTTT
GTTTGCTAGAGAGTCATTCGAAAAAACCAAGGCTAAGAATGAGTTTGTTGTTGCGGGTTGGGAATCTAAGGTGAACGCTT
GA