Details for Capsella Locus Carubv10020923m

Position : scaf_2 ( 5`- 11734234 .. 11735669 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10020923m

Protein [Map View]
MILSKRPHLMIRKLSEMLVPRSRSAIKPEDSTASPRSPLDLKFPSPVSSKRYGSRGVGLGIVAALEETRIGIHDPVRYSG
RFRCPEVDLSDEEYTYVTSPNGPTKVYYNDDDGFELSENDYRRVHKPIVIAEEPPVIIKRQTFRDSTEFLSSCCLCEKKL
QGKDIYMYKGEMGFCSAECRSVQIMNEERKEQCKTQVSRNVQVSSSPYATGQRLSAGIFVF*

DNA
ATGATACTAAGCAAGAGACCTCATCTAATGATCCGTAAATTGTCTGAGATGTTGGTTCCAAGAAGCCGATCTGCTATTAA
ACCGGAAGATTCCACGGCCAGCCCCAGAAGTCCCTTGGATTTGAAATTCCCCTCGCCGGTTAGCTCGAAGCGGTACGGTT
CTCGTGGTGTCGGTTTGGGTATCGTAGCTGCGTTGGAGGAAACTAGAATCGGGATTCACGATCCGGTTCGTTACTCCGGG
AGATTCCGTTGCCCTGAGGTCGATCTGTCGGACGAGGAATACACTTACGTCACGAGCCCTAACGGCCCGACCAAAGTTTA
CTACAACGACGACGACGGGTTTGAACTGAGTGAAAATGATTACCGGAGAGTGCATAAACCGATTGTTATCGCCGAGGAAC
CACCGGTTATTATTAAAAGGCAGACTTTTAGGGATTCGACAGAGTTTCTGAGCTCGTGTTGCTTGTGTGAGAAGAAACTT
CAAGGCAAAGACATATACATGTACAAAGGAGAGATGGGATTCTGTAGTGCTGAATGCAGATCAGTGCAAATAATGAATGA
GGAACGAAAAGAGCAATGTAAAACGCAAGTTTCAAGAAACGTACAAGTTTCGAGCTCTCCTTACGCCACCGGACAGAGAT
TATCTGCCGGAATATTCGTGTTTTAG