Details for Capsella Locus Carubv10020854m

Position : scaf_2 ( 5`- 11662872 .. 11665841 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10020854m

Protein [Map View]
LVEITKTSSDVAVSLSPSVPDSVRTAKQTTHEKKNLERNFFHRFDLIFTPMAVVGAPISSPAAHLQTRFLSNPVIPRFRR
SFSAGKSPASFSVVSMAPQKKVNKYDAKWKKQWYGAGLFFEGSEQVNVDVFKKLEKRKVLSNVEKSGLLSKAEELGLTLS
SLEKLKVFSKAEELGLLSLLENLAGTSPAVLASAALPALTAAIVAIVVIPDDSTTLVVAQTVLAGALALTGVVLLVGSVV
LDGLQEAD*

DNA
TTGGTTGAAATTACAAAGACATCATCTGACGTGGCAGTTTCTCTGTCTCCCAGTGTTCCAGATAGTGTGCGAACGGCGAA
ACAAACAACACACGAAAAGAAAAATCTCGAAAGAAACTTTTTTCATCGCTTCGATTTGATCTTTACTCCAATGGCTGTCG
TCGGCGCTCCTATATCGTCTCCGGCGGCTCATCTCCAAACACGTTTTCTCTCTAATCCCGTTATTCCCCGCTTTCGCCGG
TCTTTCTCCGCCGGTAAATCACCAGCTTCTTTCTCTGTCGTGTCCATGGCTCCTCAGAAAAAGGTGAACAAATATGATGC
CAAATGGAAGAAACAATGGTACGGAGCTGGATTGTTCTTCGAAGGTAGTGAGCAAGTAAACGTAGACGTTTTCAAGAAGC
TGGAGAAGCGAAAAGTTCTGAGCAACGTTGAGAAATCTGGCCTGCTCTCAAAAGCAGAGGAGTTGGGACTTACATTGTCA
TCACTTGAGAAGCTTAAAGTCTTCTCCAAAGCAGAGGAGCTTGGTCTTCTCAGTCTCCTCGAAAATTTAGCCGGAACATC
GCCTGCGGTCTTAGCCTCGGCTGCATTACCTGCTTTGACGGCTGCAATTGTAGCCATTGTGGTGATCCCGGATGACTCAA
CAACTCTGGTGGTAGCTCAGACGGTTTTGGCTGGTGCTCTTGCGCTTACAGGCGTTGTTTTGTTGGTTGGATCTGTTGTT
TTGGATGGACTTCAAGAAGCTGACTGA