Details for Capsella Locus Carubv10020844m

Position : scaf_2 ( 5`- 11736879 .. 11738922 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10020844m

Protein [Map View]
MSSSAECWDFSGRKPSFSQTCSRLSRYLKEKGSFGDLTLGMTCKPDLNGGFAASRQPTMMNLFPCEASKMDSLDGQDIKP
KKMFPRQSSFSSSSSTGTKEEVQMIKETKSVKLESESAPLTIFYGGRVMVFDEFSAEKAKEVIDLANKGSAKSFTGFTAE
VNQIAYTQNLAKSQKEFASIPNLAASPTKTASPEPIQPNPSSLACELPIARRASLHRFLEKRKDRITSKAPYKIDGSGEA
SSKLNPAWLGSR*

DNA
ATGTCGAGTTCTGCCGAGTGTTGGGACTTCTCTGGTCGGAAACCGAGCTTCTCGCAGACGTGTAGTCGATTGAGTCGTTA
TCTTAAGGAGAAGGGTAGTTTCGGAGATCTCACCTTGGGCATGACATGCAAGCCCGACCTCAATGGAGGTTTTGCTGCGT
CACGTCAGCCTACAATGATGAATCTGTTCCCTTGTGAAGCTTCAAAAATGGATTCTTTGGATGGTCAAGACATCAAACCC
AAGAAAATGTTCCCGAGACAATCAAGCTTTTCTTCTTCCTCTTCCACTGGGACCAAGGAAGAAGTCCAGATGATCAAAGA
GACTAAATCCGTGAAGCTGGAGTCTGAATCTGCTCCATTGACTATATTCTATGGTGGTCGAGTTATGGTGTTTGATGAAT
TTTCTGCTGAGAAAGCCAAAGAAGTCATTGATTTGGCTAACAAAGGAAGTGCCAAAAGCTTCACAGGTTTCACAGCTGAA
GTGAACCAGATTGCTTATACTCAAAACTTAGCCAAGAGTCAAAAAGAGTTTGCTTCTATCCCAAATCTAGCTGCTAGTCC
TACAAAAACTGCATCACCAGAGCCGATCCAGCCCAACCCGTCCTCCTTAGCCTGTGAACTCCCTATTGCTAGAAGAGCTT
CGCTTCATCGATTCCTTGAGAAGAGGAAGGATAGGATTACATCAAAGGCACCATACAAGATAGATGGTTCAGGTGAAGCG
TCTTCCAAGCTTAACCCAGCTTGGCTTGGTTCTCGGTAA