Details for Capsella Locus Carubv10020817m

Position : scaf_2 ( 5`- 11214984 .. 11216418 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10020817m

Protein [Map View]
RGTFTIYIKKLSQKPNPLHKHLLSSSSSFFIHTLQSNRSLLRIGKIAAEQEENNIINKFFLKMTGFYVSLFISNFSNVTS
HLSPTFDNIPSKKIVPTPIEKVVSLVSRTGRDLQRYNSSGHRQVVGCVPYRYKNHGCGGGEIEVLLISAQKKGKGMLLPK
GGWEVDESIEEAALRETIEEAGVTGQLEESLGKWQYKSKRHSMVHDGYMFPLLVSQQFEQWPEAEIRQRRWVSLSEAVEL
CENSWMREALEAFIDRKCQTH*

DNA
CGTGGAACATTTACTATATATATAAAGAAGCTTTCCCAGAAACCCAATCCTCTTCATAAACATCTCTTATCATCTTCCTC
CTCCTTTTTTATCCATACACTCCAATCAAATCGATCTTTGCTTCGAATCGGAAAAATTGCGGCGGAGCAAGAAGAAAACA
ACATCATCAACAAATTTTTTTTAAAAATGACAGGATTCTATGTGTCTTTATTCATATCAAACTTTTCAAACGTTACATCG
CACTTATCTCCGACGTTTGATAACATCCCTTCCAAGAAGATCGTACCGACACCGATTGAGAAAGTTGTATCTCTAGTCTC
TCGGACCGGACGAGATCTGCAACGTTACAATAGCTCTGGTCATCGTCAAGTCGTCGGATGTGTACCTTACAGATACAAGA
ATCATGGGTGTGGTGGTGGAGAGATTGAAGTGCTTTTGATAAGCGCACAGAAGAAAGGGAAAGGGATGTTATTACCTAAA
GGAGGTTGGGAGGTTGATGAATCAATCGAAGAAGCTGCTTTGAGAGAGACCATTGAAGAAGCTGGTGTTACGGGTCAGCT
TGAAGAATCACTTGGGAAATGGCAATACAAAAGCAAAAGACATAGCATGGTTCACGACGGTTACATGTTCCCACTGCTCG
TTAGCCAGCAGTTTGAGCAATGGCCTGAAGCTGAAATCAGACAGCGCAGATGGGTTTCTTTGTCTGAAGCGGTCGAGTTG
TGTGAGAACTCGTGGATGAGGGAAGCTTTGGAAGCATTCATTGACCGGAAATGTCAGACTCACTAA