Details for Capsella Locus Carubv10020787m

Position : scaf_2 ( 5`- 11776745 .. 11779150 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10020787m

Protein [Map View]
MLEAAQNNNSSILNGGGGFSQLQSCFADCSSEEELSVLPRHTKVVVTGNNRTKSVLVGLQGVVKKAVGLGGWHWLVLTNG
IEVKLQRNALSVLEHPTGNEVDSDLEVAHTQWNNPSDMTTEDTLKPHKSKQRGHRSSRLSQKAIGRAFSCDSHSKNSSLT
HRGNMVVHRTSSTGGIFIIMLFGYSFGKMVSVQKVDLSKLDMPALLRYWRHYNLVDALPNPTKEQLTDIVQRHFMAQQMD
ELQVIVGFVQAATGMKKASRWKPKEPRNNDL*

DNA
ATGCTGGAAGCTGCGCAGAACAACAACTCAAGCATCCTCAATGGAGGAGGTGGATTCTCTCAGCTTCAGAGTTGCTTCGC
CGATTGCAGTAGCGAAGAGGAATTGTCTGTCTTACCTCGTCATACCAAAGTTGTCGTTACCGGAAACAACCGTACCAAAT
CTGTCCTCGTCGGTCTTCAAGGCGTCGTTAAAAAAGCCGTCGGACTCGGTGGTTGGCACTGGCTGGTTTTGACTAATGGA
ATTGAAGTGAAGTTGCAGAGGAATGCGCTTAGTGTCCTTGAACATCCTACAGGGAACGAAGTAGACAGTGATCTTGAAGT
CGCGCATACTCAGTGGAACAATCCCTCTGATATGACAACCGAGGACACTTTGAAGCCTCATAAGTCGAAGCAGAGAGGAC
ACAGATCATCGCGGTTATCTCAAAAGGCAATCGGCAGGGCCTTTTCTTGTGACTCACACTCAAAAAACTCGAGCTTAACA
CATCGTGGGAACATGGTAGTTCATCGGACTTCTTCTACTGGTGGGATTTTCATTATAATGCTTTTTGGTTACTCATTTGG
GAAAATGGTTTCTGTGCAGAAGGTTGATCTTTCGAAACTGGATATGCCTGCATTACTGAGATATTGGCGACATTATAACC
TCGTGGATGCTCTTCCTAATCCAACAAAGGAGCAACTGACTGACATTGTTCAGAGACACTTCATGGCTCAGCAAATGGAT
GAGCTTCAGGTAATTGTGGGATTTGTTCAGGCAGCAACAGGAATGAAGAAGGCTAGCAGGTGGAAACCAAAAGAACCCAG
AAACAATGATCTTTAA