Details for Capsella Locus Carubv10020705m

Position : scaf_2 ( 5`- 11843658 .. 11845631 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10020705m

Protein [Map View]
MDMRSHEMIERRRDDNGNNGGVISNIITTNNDDNCNGNNNNNNNTRVSCNSQTLDHHQTKSPSSFSISAAVQSPVRYREC
LKNHAASVGGSVHDGCGEFMPSGEEGTIEALRCAACDCHRNFHRKEIDGVGSSDLIAHHRHHHHHHNQYGGGRRPPPNMM
LNPLMLPPPPNYQPIHHHKYGMSPTGGGGMVTPMSVAYGGGGGGAESSSEDLNMYGQSSGEGAGAAAGQMAFSMSSSKKR
FRTKFTTEQKERMMEFAEKLGWRMNKQDEEELKRFCGEIGVKRQVFKVWMHNNKNNAKKPPTPTTL*

DNA
ATGGATATGAGAAGCCATGAAATGATAGAGAGAAGAAGAGATGACAATGGCAACAATGGTGGTGTTATTAGTAACATCAT
TACTACTAATAATGATGATAATTGCAATGGTAATAACAACAACAACAACAACACTCGTGTCTCTTGCAACTCTCAAACCC
TAGATCACCACCAAACCAAGTCTCCTTCTTCTTTTTCCATCTCCGCCGCTGTTCAATCCCCAGTACGGTACCGTGAGTGT
CTCAAGAACCACGCGGCGAGCGTCGGCGGGAGTGTACACGACGGATGCGGCGAGTTTATGCCGAGTGGTGAAGAAGGAAC
TATTGAAGCTCTCAGATGTGCTGCTTGTGATTGTCACCGTAATTTCCACAGGAAAGAGATCGACGGTGTCGGAAGCTCGG
ATTTAATCGCTCACCACCGTCATCACCACCACCACCATAACCAGTACGGCGGAGGGAGAAGACCGCCGCCGAATATGATG
CTTAACCCACTCATGCTCCCCCCGCCGCCGAATTATCAGCCGATTCATCACCACAAGTATGGAATGAGTCCTACCGGGGG
AGGAGGAATGGTGACGCCGATGAGCGTTGCTTACGGAGGAGGAGGAGGAGGAGCAGAGTCGTCGAGTGAAGATCTAAATA
TGTATGGACAGTCCAGCGGAGAGGGAGCAGGAGCGGCGGCGGGGCAAATGGCGTTCTCGATGTCGTCGTCGAAGAAACGG
TTCAGGACAAAGTTCACGACGGAGCAGAAGGAGAGGATGATGGAGTTTGCGGAGAAGCTAGGGTGGAGGATGAACAAGCA
AGACGAAGAAGAGCTTAAAAGATTCTGTGGTGAGATCGGAGTCAAGAGACAAGTCTTCAAAGTTTGGATGCATAACAACA
AGAACAATGCCAAGAAACCACCAACACCTACAACTCTCTAA