Details for Capsella Locus Carubv10020696m

Position : scaf_2 ( 5`- 11713950 .. 11715196 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10020696m

Protein [Map View]
MVADSVTDSELIHGSPVSRDISMKRKANWLCKLKQWKIDDRRKQWIYQWKRANVDEEEIGRRLKSLLKKLTDKKAWRIDY
EEGSYGFTKCHDVDDDDDEIDLVKTSSARSPTSVLKSKGSVSEDCFCCSEQMTTEEEDEVFDDAYDNWDGFRDALNAFDN
DEDDIPQLETGDLEQEEDLVPNTSQRTPEKLFHKDNKYKHDASSHQKTVQRNSKKKNKRSNSGNQEGDAEECPICSEVMD
ATDLSFQPCPCGFRICLFCHKRISENEARCPSCREQYVQTSNNSGEVGFQQRGRGTIRLSPSFRGLDRA*

DNA
ATGGTTGCTGATTCGGTCACAGACTCTGAGCTCATTCACGGCTCTCCAGTTTCTAGAGATATCTCCATGAAACGCAAGGC
GAATTGGTTGTGTAAACTGAAGCAGTGGAAGATTGATGATCGTCGCAAGCAATGGATTTATCAATGGAAAAGAGCAAACG
TAGATGAAGAAGAAATTGGCCGCAGACTCAAATCTTTGCTAAAGAAACTTACTGATAAGAAAGCTTGGAGGATTGATTAC
GAAGAAGGAAGCTACGGATTCACCAAATGCCATGATGTGGATGATGATGATGATGAGATTGATCTTGTCAAGACATCGTC
TGCTAGGAGTCCCACGAGTGTACTCAAGAGCAAAGGTTCTGTTAGTGAAGATTGCTTCTGTTGTTCTGAGCAGATGACGA
CTGAGGAAGAGGACGAAGTTTTTGACGATGCTTATGACAACTGGGATGGGTTTAGAGATGCGTTAAACGCCTTTGACAAT
GATGAAGACGACATCCCTCAACTTGAGACAGGAGATTTAGAGCAAGAAGAAGATCTCGTTCCAAATACGAGCCAGAGAAC
CCCTGAGAAGCTCTTCCATAAAGACAACAAGTACAAGCATGATGCTTCTTCACATCAAAAGACGGTTCAGAGAAATAGTA
AGAAGAAGAATAAGAGGTCTAACTCTGGGAATCAAGAAGGTGATGCAGAAGAATGTCCTATTTGCTCTGAGGTGATGGAT
GCAACGGATCTAAGTTTCCAACCATGTCCTTGTGGGTTTCGGATTTGTCTCTTCTGCCACAAGAGGATCAGTGAAAACGA
AGCACGTTGTCCATCTTGCAGGGAGCAGTATGTTCAGACGAGTAATAATAGTGGAGAAGTAGGTTTCCAGCAACGTGGTC
GTGGCACAATTCGCTTGTCTCCGTCGTTTAGAGGACTTGACAGAGCTTAA