Details for Capsella Locus Carubv10020660m

Position : scaf_2 ( 5`- 11752544 .. 11753790 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10020660m

Protein [Map View]
QKHNTHTPFINTISHFPTSHLSTASSSSSHSQHNYSDFGLSMTLSYYLAEHPTIVNFRWSPTLSYASTWSFLFAAVSSYV
ISAVTLHLLLLVILSLCHRRRGFSLGLIPALHSLSISVISAVIFVGILLSAAAEIRDTRWLWRRTRTTALQWFLCFPVGT
RASGRVFFWSYVFYLSRFLHLLRTFFSVIRRRKLSFFQLINQSSLLCISFLWLEYSQSFQVVAILLTTVSYAVVYGYRFW
TEIGLRGACFPFVVNCQAILLGCMTVCHVGVLCIHLVKRGGCNGIGAWLFNSVLNAVISLLYLKFYCKTRSMTKAKPTTT
I*

DNA
CAGAAACATAACACTCACACACCTTTTATTAACACAATCTCTCATTTTCCCACCTCACATCTCTCAACTGCTTCATCTTC
TTCATCACATTCACAACACAACTACTCTGATTTTGGTTTATCAATGACGCTGAGTTACTATTTAGCGGAGCATCCTACCA
TCGTTAACTTCCGTTGGAGTCCCACCCTATCATACGCCTCGACTTGGTCTTTCCTCTTCGCCGCCGTCTCCTCTTACGTC
ATCTCTGCCGTCACTCTCCATCTTCTCCTCCTCGTAATCCTCTCCCTCTGTCACCGCCGCCGCGGATTCTCCCTAGGTTT
GATCCCAGCCCTGCACAGCTTGTCTATTTCCGTAATCTCAGCCGTCATCTTCGTCGGTATCCTCCTCTCGGCCGCTGCAG
AGATCCGAGACACGCGTTGGCTATGGCGGCGTACGCGCACCACCGCTCTCCAATGGTTCCTCTGTTTTCCCGTAGGCACA
CGCGCTTCGGGGCGCGTCTTTTTTTGGTCTTACGTGTTTTACCTCTCTCGGTTCCTTCACTTGCTCCGCACCTTCTTCTC
CGTGATACGACGTCGTAAGCTAAGCTTCTTCCAGCTTATTAACCAGTCTTCTCTCCTCTGTATCTCCTTCCTCTGGCTCG
AATATTCCCAATCTTTTCAGGTTGTAGCGATACTGTTGACGACCGTATCGTACGCCGTTGTGTACGGGTACAGATTCTGG
ACGGAGATTGGGTTACGCGGCGCGTGTTTCCCGTTCGTCGTTAACTGTCAAGCCATTCTGTTGGGGTGTATGACGGTTTG
CCACGTAGGCGTTTTATGTATACACCTGGTCAAACGCGGCGGTTGTAACGGTATCGGTGCTTGGCTCTTTAACTCCGTTC
TTAACGCTGTTATATCGTTGCTCTACTTGAAGTTTTATTGCAAGACGCGTTCCATGACCAAGGCTAAGCCCACCACCACC
ATATAA