Details for Capsella Locus Carubv10020629m

Position : scaf_2 ( 5`- 11781822 .. 11784334 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10020629m

Protein [Map View]
MTSDGATSTSAAAAAAAAAAARRKPSWRERENNRRRERRRRAVAAKIYTGLRAQGDYNLPKHCDNNEVLKALCTEAGWVV
EEDGTTYRKGCKPLAGEIAGTSSRVTPYSSQNHSPLSSAFQSPIPSYQASPSSSSFPSPSRGEPNNNISSTYFPFLRNGG
IPSSLPSLRISNSCPVTPPVSSPTSKNPKPLPPNWESIAKQSMAMASFNYPFYAVSAPASPTHRQFHTPATIPECDESDS
STVDSGHWISFQKFAQQQPFSASMVPTSPTFNLVKPAPQQMSPNTAAFQEIGQSSDFKFDNSQVKPWEGERIHDVGMEDL
ELTLGNGKARG*

DNA
ATGACGTCCGATGGTGCTACGTCGACATCAGCAGCTGCGGCGGCGGCGGCTGCTGCTGCGGCGAGGAGGAAGCCTTCGTG
GAGAGAGAGGGAGAATAATAGGAGGAGAGAGAGACGGAGAAGAGCTGTTGCTGCCAAGATATACACTGGTCTTAGAGCTC
AAGGCGATTATAATCTGCCTAAACATTGTGATAATAATGAGGTTCTTAAGGCTCTCTGTACTGAAGCTGGTTGGGTTGTT
GAAGAAGACGGTACTACTTATCGTAAGGGATGCAAGCCTCTAGCTGGTGAGATAGCTGGTACTTCATCTCGAGTAACGCC
TTACTCATCTCAGAACCACAGCCCTCTTTCATCGGCCTTTCAAAGTCCAATCCCGTCTTACCAAGCCAGCCCGTCTTCCT
CATCTTTCCCGAGTCCGTCTCGTGGTGAACCAAACAATAACATCTCATCTACCTACTTCCCCTTCCTCAGAAATGGTGGC
ATTCCTTCCTCTCTTCCTTCCCTCAGAATCTCTAACAGTTGCCCTGTTACCCCACCTGTCTCTTCTCCTACTTCCAAGAA
TCCTAAACCCTTGCCCCCCAACTGGGAATCTATTGCCAAGCAGTCCATGGCCATGGCTTCTTTTAACTACCCTTTCTATG
CTGTTTCTGCACCTGCTAGTCCCACTCATCGCCAGTTTCATACCCCCGCTACTATACCTGAATGTGATGAGTCTGACTCT
TCCACTGTTGATTCTGGTCATTGGATAAGCTTTCAGAAGTTTGCACAACAGCAGCCTTTCTCTGCCTCCATGGTCCCAAC
TTCTCCTACTTTCAACCTTGTGAAACCCGCGCCTCAGCAGATGTCTCCAAATACTGCTGCTTTCCAAGAGATTGGTCAAA
GCTCTGACTTTAAATTTGATAATAGCCAAGTTAAACCGTGGGAAGGAGAGAGGATACATGATGTGGGTATGGAGGATCTT
GAGCTTACACTTGGAAATGGCAAGGCTCGTGGTTGA