Details for Capsella Locus Carubv10020475m

Position : scaf_2 ( 5`- 11760089 .. 11764976 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10020475m

Protein [Map View]
MEVCGHLNPDNLKNRPLTPIRILRGLMILLVFLSTAFMFLLYFSPVAALGLRLLSVHQSRRVISLIFGLWLALWPYLFET
VNGTTVVFSGDSIPGEKRVLLIANHRTEVDWMYVWNIALRKGCLGYIKYVLKSSLMRLPIFGWGFHVLEFIPVERKREVD
EPVLLQMLSSFKDPHEPLWLALFPEGTDFTEEKCKRSQKFAAEVGLPALSNVLLPKTRGFGVCLEVLHNSLDAVYDLTIA
YKPRCPSFMDNVFGTDPSEVHIHVRRIPLKEIPDNEAESSAWLMDSFQLKDKLLSDFNAQGQFPNQRPGEELSLLKCIAT
FAVVISLTVLFIYLTLYSHSCFKVYAGLSGTYLSFATYYKFRPSPGCFREDTCKVKNQ*

DNA
ATGGAAGTTTGCGGGCATCTGAATCCTGATAACTTAAAGAACCGTCCCTTGACTCCGATTAGGATTCTGAGGGGTCTGAT
GATCCTACTGGTCTTTCTGTCTACTGCTTTTATGTTCCTGCTCTACTTTTCACCAGTAGCTGCTCTAGGGCTACGGCTTC
TGAGTGTGCATCAATCTAGGAGAGTTATCTCGTTAATCTTTGGTCTCTGGCTAGCTTTGTGGCCTTACCTGTTTGAAACG
GTTAACGGGACAACTGTGGTGTTCTCTGGTGACAGCATTCCGGGTGAGAAACGTGTTTTGCTTATTGCAAATCACAGAAC
AGAGGTGGATTGGATGTATGTGTGGAACATTGCGTTGAGAAAAGGGTGTCTTGGCTACATCAAATACGTTCTTAAGAGCA
GCTTGATGAGATTGCCTATTTTTGGCTGGGGTTTTCATGTTTTGGAGTTTATACCCGTGGAGAGGAAGCGGGAGGTCGAT
GAACCTGTTTTGCTTCAAATGCTTTCATCTTTTAAGGATCCTCATGAACCCTTATGGCTTGCTCTATTCCCAGAAGGAAC
CGATTTCACTGAAGAGAAATGCAAGAGAAGCCAAAAATTTGCAGCAGAAGTTGGTCTTCCAGCATTATCAAACGTACTTT
TACCAAAAACAAGGGGTTTTGGCGTCTGCTTAGAAGTTCTTCATAACTCATTGGATGCAGTATATGATTTGACTATCGCA
TATAAGCCTCGCTGCCCATCTTTCATGGACAATGTATTTGGGACGGATCCTTCAGAAGTTCACATCCACGTTCGGCGAAT
TCCACTGAAGGAAATTCCAGATAACGAGGCAGAATCTTCTGCTTGGTTAATGGATTCATTTCAGTTAAAGGACAAACTGC
TATCCGATTTCAATGCTCAGGGACAATTTCCCAATCAAAGACCAGGAGAAGAACTCTCTCTTCTGAAGTGCATCGCAACT
TTTGCAGTGGTAATATCTTTGACAGTACTATTCATTTATCTGACCTTGTATTCACATAGCTGTTTCAAAGTATATGCTGG
TCTAAGCGGCACATATTTATCGTTTGCTACTTATTACAAGTTCCGACCCTCACCTGGCTGTTTTAGAGAAGATACTTGTA
AAGTAAAGAACCAGTAA