Details for Capsella Locus Carubv10020445m

Position : scaf_2 ( 5`- 11710298 .. 11712818 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10020445m

Protein [Map View]
MADPETLAALKRAYADTILNTTKEAAARVMVSEKKARRYQQELVTVRDDALQTLVRLKQMLDSKVKETEIISLKQQQKVE
ELEAQLGEAEDIVGELRAELRVLHDELKRLTNGQTHLKSDHEEDPHWKNRDAAVSVVPEVSSSHESTEAIASCIPVEQSE
SVVANGMTRINSINRCSYKNNKDQCHHSLPSILTKRREAEGSTQIIHAVDSSIANGDLSSSVEVGDVNDGGCLHKVSSCK
SVETLNESGCADATDSISSVRDGEAPIVSPNAPQKDDGTPIFLKTSPLTISKTDARKEEKESCENMEVSASPLCEETPVL
ALNKNRCIKYTFKRKRKKEVLSNLEGSSSFEESRNMKQKTGEKDDVYLDSLKPSFTSESSRDVVYA*

DNA
ATGGCCGACCCAGAGACCTTAGCGGCGTTGAAGAGAGCTTACGCCGATACGATACTGAACACGACGAAGGAAGCGGCGGC
GCGTGTGATGGTTTCTGAGAAGAAGGCGCGTAGGTATCAGCAAGAACTTGTTACAGTTAGAGATGATGCACTCCAAACGT
TGGTTAGGCTTAAACAGATGCTTGATTCCAAGGTAAAGGAGACAGAGATAATATCCTTGAAGCAGCAACAGAAGGTTGAG
GAACTGGAAGCTCAGCTTGGAGAAGCTGAAGATATTGTAGGAGAGCTGAGGGCGGAGTTGAGAGTACTTCACGATGAGCT
CAAGAGACTTACGAATGGTCAGACACATCTCAAAAGTGACCATGAGGAAGACCCCCATTGGAAAAACCGTGATGCAGCAG
TTTCTGTAGTGCCTGAGGTTTCTAGCAGTCATGAGAGCACAGAAGCTATAGCTTCTTGCATCCCAGTTGAACAAAGTGAA
TCGGTGGTGGCTAATGGGATGACTCGCATTAATAGTATCAACCGGTGTTCTTATAAAAATAACAAGGATCAGTGTCACCA
CTCTCTTCCTTCTATACTGACAAAACGCAGGGAAGCTGAAGGTAGCACTCAGATAATTCACGCAGTAGATAGCAGTATAG
CCAATGGAGATCTGTCTTCCTCTGTAGAAGTAGGAGATGTGAATGATGGAGGTTGTCTTCACAAAGTTTCTTCGTGTAAA
AGTGTAGAGACCTTAAACGAGTCTGGTTGTGCTGATGCTACTGACTCCATATCTTCTGTTAGAGATGGAGAAGCCCCAAT
AGTGTCTCCAAATGCTCCTCAGAAGGATGATGGCACTCCCATATTCTTGAAAACATCTCCTCTGACAATTAGCAAAACAG
ATGCAAGGAAGGAAGAAAAAGAGAGCTGTGAGAATATGGAGGTTTCAGCATCTCCTTTGTGCGAAGAAACTCCAGTTTTG
GCACTTAATAAAAATCGGTGTATCAAGTACACGTTCAAGAGGAAGAGAAAGAAGGAGGTTTTAAGCAACCTTGAAGGAAG
TTCATCGTTTGAAGAGAGCAGAAACATGAAACAGAAGACTGGGGAAAAAGACGATGTTTATTTGGATTCTCTGAAGCCTA
GCTTTACCAGTGAATCATCTCGAGATGTAGTCTATGCTTAG