Details for Capsella Locus Carubv10020370m

Position : scaf_2 ( 5`- 11723480 .. 11726179 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10020370m

Protein [Map View]
MGSSMEEKVVAVIMVGGPTKGTRFRPLSLNIPKPLFPIAGQPMVHHPISACKRIPNLAQIYLVGFYEEREFALYVSAISN
ELKVPVRYLREDKPHGSAGGLYHFRNLIMEDSPSHIFLLNCDVCCSFPLPEMLEAHRGYGGIGTLLVIKVSPESASQFGE
LVADPVTNELLHYTEKPETFVSDRINCGVYVFTPEIFNAIGDVSTQRKDRATLKRVSSFEALQPATRIPTDFVRLDQDIL
SPLAGKKQLYTYETMDFWEQIKSPGMSLRCSGLYLSQFHLTSPQLLASGDGTRSAIVIGDVYIHPSAKVHPTAKIGPNVS
ISANARVGPGVRLISCIILDNVEIMENAVVTNAIVGWKSSIGRWSRVQAEGVYNSKLGVTILGESVAVEDEVVVTSSIVL
PNKTLNVSVQDEIIL*

DNA
ATGGGGAGCTCAATGGAGGAGAAAGTGGTTGCTGTGATCATGGTCGGTGGTCCAACCAAAGGTACTCGGTTTCGACCATT
GTCACTGAACATTCCAAAGCCTCTGTTTCCAATTGCGGGACAACCAATGGTGCATCATCCAATTTCAGCTTGTAAAAGAA
TTCCAAATTTAGCTCAAATATATCTTGTTGGCTTCTATGAGGAAAGGGAATTTGCACTTTATGTCTCAGCCATCTCTAAT
GAACTCAAAGTTCCTGTTAGATATCTGCGAGAAGACAAACCACATGGTTCAGCTGGTGGGCTGTATCACTTTAGAAATCT
AATTATGGAGGATAGCCCGTCTCATATCTTCCTGCTTAACTGTGATGTTTGTTGCAGTTTCCCCTTGCCGGAAATGCTTG
AGGCTCACAGGGGATATGGTGGAATTGGAACTCTTCTTGTGATCAAGGTCTCTCCTGAATCAGCCAGCCAATTTGGAGAA
TTGGTTGCAGATCCAGTTACTAATGAGCTGCTTCATTACACTGAGAAACCCGAAACTTTTGTCAGTGATCGTATTAACTG
CGGTGTTTATGTCTTTACACCTGAAATTTTTAATGCCATAGGAGATGTGTCTACTCAGAGGAAAGATAGAGCAACTCTAA
AACGTGTTTCCAGCTTCGAAGCTCTTCAACCGGCGACAAGGATCCCGACTGATTTTGTAAGACTGGATCAAGATATCCTT
TCACCTCTAGCTGGAAAGAAACAGCTATATACATATGAGACAATGGACTTCTGGGAGCAAATTAAGTCTCCCGGAATGTC
GCTGCGGTGTTCCGGACTCTATCTTTCCCAATTCCATTTGACCTCTCCCCAACTGTTGGCTAGTGGTGATGGAACAAGGA
GTGCCATTGTAATTGGTGATGTTTACATACATCCTTCTGCAAAAGTACACCCAACTGCAAAGATTGGCCCCAACGTCTCA
ATCTCTGCAAATGCTCGTGTTGGACCGGGTGTCAGGCTTATCAGCTGTATCATTCTTGACAATGTTGAGATCATGGAAAA
TGCAGTGGTGACTAACGCAATTGTTGGGTGGAAATCTTCTATCGGGAGATGGTCCCGCGTCCAGGCTGAGGGAGTCTACA
ATTCCAAACTCGGAGTTACAATTCTCGGAGAGTCGGTAGCAGTTGAAGACGAGGTTGTGGTGACCAGCAGTATTGTTCTT
CCAAACAAGACACTCAATGTCAGTGTTCAAGACGAGATCATTTTGTAA