Details for Capsella Locus Carubv10020236m

Position : scaf_2 ( 5`- 11192866 .. 11196662 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10020236m

Protein [Map View]
MICSSKGTILIARGENSNSTPRLGLTVSSTDYANRIPTRNNPISVKTFRRSSSPSMAVETMSMGSDSSTLILTSGASGRV
RVLFSMRELKRLVTIIQSLILFLLLPFRVVVWRRRTGSTVVIRDDKQERKVWSPPQIVVRKRSSGGGESGVSVSPPSVPA
AVVDEEVAVRRELAIRRVLEDEGGDGSSVRDYSLFTTKRGDTLFTQSWSPLSPNHRGLVVLLHGLNEHSGRYNDFAKQLN
ANGFKVYGIDWIGHGGSDGLHAYVPSLDYAVTDLKSFLDKVLTENPGLPCFCIGHSTGGAIILKAMLDPKIESRVSGIAL
TSPAVGVQPSHPIFTVLAPIMAFLLPRYQISAANKKGMPVSRDPAALVAKYSDPLVFTGSIRVKTGYEILRITAHLQQNL
NKVKVPFLVMHGTDDTVTDPNATKKLYEEASSSDKSIKLYDGLLHDLLFEPEREIIAGEILDWLNQRV*

DNA
ATGATCTGTTCAAGCAAAGGAACAATCTTAATCGCTAGAGGTGAAAATTCGAATTCAACCCCCAGATTAGGCCTAACAGT
TTCATCCACAGATTACGCGAATCGGATTCCAACTCGAAACAATCCAATCAGCGTCAAAACTTTCCGGCGATCATCGTCAC
CGTCAATGGCGGTGGAAACAATGTCGATGGGATCAGATTCTTCAACTTTGATTCTTACCTCAGGAGCAAGCGGTCGCGTT
AGGGTACTCTTCTCGATGCGAGAGCTCAAGCGTCTCGTTACCATCATCCAATCTCTTATTCTCTTCCTTCTCCTTCCTTT
TCGCGTCGTCGTTTGGCGGCGGAGGACCGGTTCCACGGTCGTCATCAGAGACGATAAGCAGGAGAGGAAGGTCTGGTCTC
CGCCTCAGATCGTCGTGAGGAAGAGGAGCAGCGGCGGCGGCGAATCCGGTGTAAGCGTTTCGCCTCCTTCTGTTCCAGCG
GCGGTGGTGGATGAGGAGGTTGCGGTTAGACGGGAGCTGGCGATTAGGCGAGTTTTGGAGGATGAAGGCGGCGATGGAAG
CTCCGTCAGAGATTATTCACTTTTCACGACCAAGAGAGGTGATACGTTGTTCACTCAGTCATGGTCACCTCTTTCCCCAA
ATCACAGGGGACTTGTTGTTCTGCTACATGGACTAAACGAGCACAGTGGTAGGTATAATGACTTTGCAAAGCAGCTAAAT
GCTAATGGGTTCAAGGTCTATGGAATTGACTGGATTGGTCATGGTGGAAGCGATGGACTTCATGCTTACGTTCCTTCCCT
TGATTACGCTGTCACAGATTTGAAATCATTTCTGGATAAGGTATTAACAGAGAATCCAGGGCTCCCCTGTTTCTGCATTG
GACACTCAACAGGAGGAGCGATCATCCTCAAGGCTATGCTGGATCCAAAGATTGAATCTCGAGTTTCAGGCATTGCATTG
ACTTCACCAGCTGTTGGAGTCCAACCATCCCATCCAATCTTCACAGTTCTTGCCCCAATCATGGCGTTCCTCCTGCCCAG
GTACCAAATAAGTGCAGCAAACAAGAAAGGAATGCCAGTTTCTCGTGACCCAGCAGCTCTCGTTGCCAAGTATTCTGACC
CATTAGTCTTCACCGGATCCATCCGAGTTAAAACCGGCTACGAGATCCTTAGAATCACTGCTCACTTGCAACAGAACCTG
AACAAAGTGAAAGTTCCTTTTCTTGTGATGCACGGAACAGACGATACAGTGACCGATCCCAACGCCACAAAGAAACTCTA
CGAGGAAGCTTCGTCGTCAGACAAATCGATCAAGCTCTACGATGGGTTGTTGCACGATCTTCTCTTTGAACCCGAGCGAG
AAATCATAGCTGGGGAGATTTTAGATTGGCTGAACCAGCGGGTTTAG