Details for Capsella Locus Carubv10020148m

Position : scaf_2 ( 5`- 11850287 .. 11851843 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10020148m

Protein [Map View]
MPPFRFYIPFFSSNSPSRLSSGTSSSPSPPPTPSPSTRPPFRPAGIAQPSKPETKPKATPSLSRVRSNGAAIAAALSASP
SRGTATPTRLAKPTTQQLGSPSKKLESPRKEEKKVTMKEKPSRDTENVVSEKINPVTEKPPIARPEENLERKETDAVQEQ
RKKTEAEKQAVQEKKKALPEGSGEKKSAADQGQQKRKEIEKLAVQERKEVLHDGGREKSEADQGQQKRNEKEKLALQETK
RALQTAGREDTTLSKSTRHMAAASGAPRDLPERETKTQNRTEIHTDGDHQKTKVASTSNTGNPRVTNGQGSSSMSKKIKE
DIKDGISKLTWGKSNGDEKSVNVYTLTGENRGATMGISSEKDKKDGEVHIRRGYRSNPDESPNTTATEPEGGRNPKDYDE
EKEEARFRAYINGNTQGINNSIIVESSVSENDPGVHMSLTFEKSMKEIINPPEKNVTEKRPETEKVTEKVRNEPRVRRRC
LRGLLAESSESEPGNPLKSRRHGCRFTCKDKDIENTSK*

DNA
ATGCCTCCTTTCCGTTTTTACATCCCATTCTTCTCCTCCAACTCTCCTTCTCGTCTCTCTTCAGGGACTAGTTCTTCGCC
ATCACCACCACCTACTCCTTCTCCTTCTACACGACCTCCTTTTCGTCCTGCAGGCATTGCTCAGCCCTCAAAGCCAGAAA
CAAAGCCTAAGGCGACTCCCTCACTTTCTAGGGTTAGAAGCAACGGTGCGGCCATTGCTGCTGCTTTGTCTGCGTCACCT
TCTCGTGGTACAGCCACTCCAACCCGGCTGGCAAAACCGACTACCCAACAACTTGGTTCGCCGTCAAAGAAACTGGAATC
TCCGAGGAAGGAGGAGAAAAAGGTAACGATGAAAGAGAAGCCATCGAGAGACACTGAAAATGTAGTTAGCGAGAAAATAA
ATCCGGTGACAGAGAAACCTCCTATTGCTCGTCCAGAAGAGAATTTAGAGCGAAAAGAAACAGATGCAGTTCAGGAACAG
AGGAAGAAGACAGAAGCAGAGAAACAAGCGGTGCAAGAAAAGAAGAAAGCTCTTCCTGAAGGTAGTGGAGAGAAGAAGTC
AGCAGCAGATCAGGGACAACAGAAGAGAAAAGAAATCGAGAAACTTGCGGTACAAGAAAGGAAGGAAGTTCTTCATGACG
GCGGTAGAGAGAAGTCAGAAGCTGACCAGGGACAACAAAAGAGAAATGAAAAGGAGAAACTTGCGTTACAAGAAACGAAG
AGAGCTCTTCAGACTGCTGGTAGAGAAGATACAACGCTAAGCAAATCCACACGACATATGGCAGCAGCATCAGGAGCACC
GAGAGATCTACCGGAGAGAGAGACAAAAACGCAAAACAGAACAGAGATTCACACCGATGGCGACCATCAGAAAACCAAAG
TCGCATCAACGAGTAATACTGGAAATCCGAGAGTTACAAATGGACAAGGATCATCTTCAATGAGCAAAAAGATCAAAGAA
GACATAAAAGATGGAATCAGTAAGCTTACTTGGGGAAAAAGCAACGGCGATGAGAAATCCGTGAACGTCTATACTCTAAC
TGGCGAAAACAGAGGAGCTACAATGGGAATAAGTTCTGAGAAAGACAAAAAAGACGGTGAGGTTCATATTCGCCGTGGAT
ACAGAAGTAACCCAGACGAGAGCCCTAACACTACAGCCACGGAACCCGAAGGAGGAAGAAACCCTAAAGACTACGACGAA
GAAAAAGAAGAAGCAAGGTTCAGGGCATACATAAACGGCAACACTCAAGGGATCAACAATTCGATTATAGTTGAGAGTTC
AGTGAGTGAGAATGATCCAGGAGTTCACATGAGTTTGACATTTGAGAAATCTATGAAAGAAATTATAAACCCCCCTGAGA
AGAATGTGACGGAGAAGAGACCAGAGACGGAAAAGGTTACGGAGAAGGTGAGGAATGAGCCGAGAGTTAGAAGGAGATGC
TTAAGAGGGTTACTTGCGGAGTCAAGTGAGTCTGAACCGGGTAATCCTTTGAAGTCCCGGAGACATGGTTGCCGGTTTAC
CTGTAAAGACAAAGATATAGAGAACACTTCAAAATAA