Details for Capsella Locus Carubv10020101m

Position : scaf_2 ( 5`- 11740349 .. 11744869 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10020101m

Protein [Map View]
MVGASSCYASPLCTWFVAACMSVAHGPGDSRQAVALQSGGRSRRRRQLSKCSPASGSAPTIQALVTSCLDFGPCTHYNSN
YNALSSLFGSNTVSSNRNQRRLNRAATSGRAMAVMEMEKEAAVNKKPPTEQRRVVVTGMGVETSLGHDPHTFYDNLLQGN
SGISQIENFDCSEFPTRIAGEIKSFSTEGWVAPKLSKRMDKFMLYLLTAGKKALADGGVTEEVMAEFDKTKCGVLIGSAM
GGMKVFYDAIEALRISYKKMNPFCVPFATTNMGSAMLAMDLGWMGPNYSISTACATSNFCILNSANHIIKGEADVMLCGG
SDAVIIPIGLGGFVACRALSQRNNDPTKASRPWDSNRDGFVMGEGAGVLLLEELEHAKKRGATIYAEFLGGSFTCDAYHM
TEPHPDGAGVILCIERALASAGVSREQINYINAHATSTHAGDLREYQALVHCFGQNPELKVNSTKSMIGHLLGAAGAVEA
VATVQAIRTGWVHPNINLENPDNGVDTKLMVGPKKERLNIKAALSNSFGFGGHNSSIIFAPYK*

DNA
ATGGTGGGTGCGTCTTCTTGCTACGCATCTCCGTTATGCACCTGGTTCGTTGCTGCTTGCATGTCCGTCGCTCACGGCCC
TGGAGATAGCCGCCAGGCTGTTGCGCTTCAATCTGGTGGGCGGAGTCGGCGAAGGAGGCAGCTTAGCAAGTGCTCCCCCG
CTTCTGGATCCGCTCCTACCATTCAAGCTCTTGTCACTTCTTGTTTGGATTTTGGTCCCTGTACTCACTACAACAGCAAC
TACAATGCCTTGTCTTCTCTCTTTGGATCGAATACTGTTTCGTCCAATCGTAACCAGAGGAGACTGAATCGAGCTGCTAC
TTCCGGTCGAGCCATGGCTGTGATGGAGATGGAAAAGGAAGCTGCGGTTAACAAGAAACCGCCTACGGAGCAGCGTCGGG
TTGTAGTCACAGGCATGGGAGTTGAAACATCATTAGGTCATGACCCGCATACCTTTTATGATAATTTGCTACAAGGCAAC
AGTGGTATTAGCCAGATTGAGAATTTTGATTGTTCTGAATTTCCTACGCGAATTGCGGGGGAGATCAAAAGCTTCTCGAC
TGAAGGATGGGTAGCTCCAAAACTTTCTAAAAGGATGGACAAGTTCATGCTCTATCTTCTCACTGCTGGGAAGAAAGCTT
TGGCTGATGGTGGAGTAACTGAAGAAGTTATGGCAGAGTTTGACAAAACGAAATGCGGAGTGCTGATTGGCTCAGCAATG
GGAGGAATGAAGGTCTTTTACGATGCTATTGAAGCTCTGAGAATCTCTTACAAGAAGATGAATCCTTTTTGTGTACCTTT
TGCGACAACAAACATGGGTTCTGCTATGCTTGCTATGGATCTGGGATGGATGGGGCCAAACTATTCTATTTCAACTGCTT
GTGCTACAAGCAACTTTTGCATTCTGAATTCAGCAAATCACATTATTAAGGGGGAAGCTGATGTAATGCTCTGTGGTGGC
TCAGATGCAGTTATTATTCCAATAGGGTTGGGAGGTTTTGTTGCATGCCGGGCTCTTTCACAAAGGAATAATGATCCCAC
AAAAGCTTCACGTCCTTGGGATAGTAATCGAGATGGCTTCGTGATGGGAGAGGGAGCTGGAGTTTTACTTTTGGAAGAAC
TTGAGCATGCTAAGAAAAGAGGAGCAACTATCTATGCAGAGTTCCTTGGTGGGAGTTTCACATGTGATGCGTATCACATG
ACTGAGCCTCACCCTGATGGTGCTGGTGTCATCCTCTGTATCGAGAGAGCGTTAGCTAGTGCTGGGGTTTCCAGGGAACA
GATAAATTACATAAATGCACATGCAACCTCAACACACGCTGGAGACCTCAGGGAGTACCAAGCCCTTGTTCATTGTTTTG
GCCAAAATCCTGAGCTTAAGGTAAATTCCACAAAGTCTATGATTGGACATTTGCTGGGAGCTGCTGGGGCAGTGGAGGCT
GTTGCAACAGTGCAGGCAATAAGAACCGGATGGGTTCATCCAAATATCAACCTCGAGAATCCAGACAATGGAGTGGATAC
AAAGCTGATGGTGGGTCCTAAGAAGGAGAGATTGAACATTAAAGCAGCCTTGTCAAATTCTTTCGGGTTTGGTGGGCATA
ACTCGAGCATTATTTTCGCTCCTTACAAGTGA