Details for Capsella Locus Carubv10019957m

Position : scaf_2 ( 5`- 11825018 .. 11830485 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10019957m

Protein [Map View]
MSEWCISSNPTFSTAFPSSCFPVVPIILSPEFDSQCLFNSLTTTMRLSKRQLSLPLSLCFSTFSPRFRLPGKFSPRRDSL
HTTGTSQLCFKSSMEEQKPSALSDNVLQFHTVGSRDGCDVPHKWSSPGEGKKIDISKQIFCNRSLNMRNIIAVGFDMDYT
LAQYKSETFESLAYEGTVRKLVYDLGYPNELLEWTFDWNYMVRGLVLDKKRGNILKMDRHKYVKVAYHGFRELSKEDKVD
IYGSSLVRDSFDEPDYALIDTLFSLAEAYLFAQLVDFKDNNPEKIPKGVDYARMYKDVRAAVDLCHRDGTLKQMVAKEPY
RYINEDTTIIPLIKMIRDSGRSTFLVTNSLWDYTNIVMNFLCGGRTVHGPHTCNFDWLQYFDVVITGSAKPGFFHEESRA
NLFEVEPKSGMLINTDNGTPMAQVGDPSPKLLLKSRDKGCRVFQGGNVGHLHSLLSIESSSQVLYVGDHIYGDILRSKKV
LGWRTMLVVPELEKEVELLWGMRNMRKELILMRNERDSVEDKIHHLNWSLKFEDINENDKLEMLSALKDLESKRDQVRLR
HQQAQRECHQKFHKVWGQLMKTGYQSSRFAHQVERFACLYTSQVSNLLLYSPDKYYRPSEDFMSHEFHLLPL*

DNA
ATGTCTGAGTGGTGTATCAGTTCGAATCCAACTTTTTCGACGGCATTCCCAAGTAGTTGTTTTCCAGTTGTACCTATTAT
TCTTTCTCCAGAATTCGATTCTCAATGCCTATTTAATAGCTTAACCACCACCATGCGTCTCTCCAAACGCCAACTCTCTC
TTCCTCTTTCTCTCTGCTTCTCTACCTTCTCTCCTCGCTTCCGTCTCCCCGGAAAATTTTCGCCTCGACGAGATTCTCTC
CACACCACTGGGACAAGCCAGCTGTGTTTTAAGAGTTCGATGGAAGAACAGAAGCCGAGTGCTCTCAGTGACAATGTGTT
GCAGTTTCACACTGTCGGTTCCAGGGATGGATGTGACGTTCCCCACAAATGGTCCTCCCCTGGAGAAGGGAAGAAAATTG
ATATAAGCAAACAAATTTTCTGCAACAGATCGTTGAATATGAGAAATATCATTGCCGTAGGCTTTGATATGGACTACACT
CTTGCCCAATACAAGTCTGAAACTTTCGAGTCCCTTGCTTATGAAGGAACTGTCAGGAAATTGGTATATGATTTGGGGTA
TCCAAATGAGCTGCTAGAGTGGACATTTGATTGGAATTACATGGTTAGGGGCTTGGTGCTAGACAAAAAGAGGGGAAACA
TCTTAAAGATGGACCGCCATAAATATGTGAAAGTAGCTTACCATGGGTTTAGGGAGCTATCTAAGGAAGACAAAGTTGAC
ATCTATGGAAGTAGCCTAGTACGAGATTCTTTTGATGAACCCGACTACGCTCTCATAGATACTCTCTTTTCATTAGCCGA
AGCCTATTTGTTTGCGCAACTCGTTGATTTTAAAGATAATAACCCAGAAAAAATTCCGAAGGGCGTTGATTATGCTCGGA
TGTATAAAGATGTTCGTGCTGCTGTTGATTTGTGCCACCGCGACGGAACTTTAAAGCAGATGGTAGCAAAAGAACCTTAT
AGGTATATCAATGAGGATACCACAATAATACCCCTTATAAAAATGATAAGAGATTCTGGACGTTCTACATTCTTGGTGAC
CAATAGCTTGTGGGACTACACAAATATTGTGATGAATTTTCTCTGTGGAGGGCGCACAGTACATGGTCCTCATACTTGCA
ACTTTGATTGGCTCCAGTATTTTGATGTTGTGATAACTGGCAGTGCAAAACCGGGTTTCTTCCATGAAGAGAGCCGTGCT
AACCTTTTTGAGGTGGAACCTAAGTCTGGAATGCTTATTAATACTGACAATGGAACACCTATGGCTCAGGTGGGAGATCC
TTCACCAAAATTGTTACTGAAGAGTAGAGATAAAGGTTGTCGAGTTTTCCAAGGTGGAAATGTTGGGCATCTTCACAGTT
TGCTCTCCATTGAGTCAAGTTCACAGGTACTTTATGTTGGTGATCATATATACGGTGATATCTTGCGCAGCAAAAAAGTA
CTTGGCTGGAGAACTATGCTTGTAGTTCCAGAACTAGAAAAAGAGGTCGAACTTTTATGGGGAATGAGGAATATGCGTAA
GGAACTTATATTGATGAGGAATGAGCGTGATTCAGTTGAAGACAAAATTCATCACTTGAACTGGTCTCTAAAGTTTGAGG
ATATTAACGAGAATGATAAGCTGGAAATGTTATCAGCGCTCAAGGACTTAGAGTCTAAAAGAGATCAAGTACGACTGAGA
CACCAACAAGCTCAAAGAGAATGTCACCAAAAGTTTCACAAGGTCTGGGGACAACTGATGAAAACTGGCTACCAGAGTTC
TCGATTTGCTCATCAGGTGGAGAGATTCGCATGCCTATACACAAGCCAAGTCTCAAACCTGCTCTTGTACTCTCCAGACA
AGTATTACAGACCCAGTGAAGACTTCATGTCCCATGAATTTCACCTTCTTCCTCTGTGA