Details for Capsella Locus Carubv10019936m

Position : scaf_2 ( 5`- 11821609 .. 11824948 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10019936m

Protein [Map View]
MSATSSLRARLAFVALLSATTFYCIHKYRRLKRLKNLSLNPSSTSKPARGKIFFISQTGTAKALAERLHELCASNEIAFD
LIDPRSYEPEDLPKETLVIFITSTWDGGKPPKNGEFLVNWLGESAEDFRVGSLLLSDCKFGVFGVGSRAYGESYNAVAKE
LSSRMIGLGGLEMIPVGEGDVDDGELDKAFQEWCDGVIRVLKGGSVQETNGVSHQNGAVENDLEYYDSTDDEDEDNDEDG
GIVDLEDIAGKAPSKRNGIVKVTKGDGKKEMVTPVIRASLTKQGYKIIGSHSGVKICRWTKSQLRGRGGCYKHSFYGIES
HRCMETTPSLACANKCVFCWRHHTNPVGKSWQWKMDEPSVIVKGALDLHTKMIKQMKGVPGVTAEKLQEGLNPRHCALSL
VGEPIMYPEINALVDELHGRRISTFLVTNAQFPEKILMMKPITQLYVSVDAATKESLKAIDRPLFADFWERFIDSLKALH
EKQQRTVYRLTLVKGWNTEELDAYFNLFSIGKPDFIEIKGVTYCGTSATSKLTMENVPWHADVKAFSEALSSKSKGEYEV
ACEHAHSCCVLLGRTEKFKVNGKWFTWIDYEKFHDLVASGEPFTSSDYMAQTPSWAVYGAEEGGFDPEQLRFKKERHHHP
KPQAVLA*

DNA
ATGTCTGCGACTTCTTCCTTACGTGCTCGACTAGCTTTCGTGGCTTTACTCTCGGCGACGACTTTTTACTGTATCCATAA
ATATCGCCGGTTGAAACGTCTCAAAAACCTCTCCTTAAACCCTAGCTCTACCTCGAAACCCGCCAGGGGAAAGATCTTTT
TCATCTCCCAAACTGGTACTGCTAAAGCGTTAGCTGAACGGCTTCACGAGCTCTGCGCATCTAATGAAATAGCATTTGAT
CTCATCGATCCACGGAGCTACGAACCTGAAGATCTACCCAAGGAAACCCTTGTTATATTCATCACCTCGACTTGGGACGG
TGGGAAGCCGCCTAAAAACGGAGAATTTCTTGTGAACTGGCTTGGTGAGAGCGCAGAGGATTTCCGAGTTGGCTCGCTTC
TTCTCTCCGATTGCAAATTCGGCGTATTTGGTGTCGGGAGCCGTGCTTATGGTGAGTCTTATAACGCTGTGGCAAAGGAA
TTATCCAGTCGGATGATAGGATTGGGTGGACTCGAGATGATTCCAGTGGGAGAAGGTGACGTTGATGACGGAGAATTAGA
CAAAGCATTTCAAGAATGGTGTGATGGAGTTATTAGGGTTCTGAAAGGAGGGTCTGTTCAAGAAACAAATGGGGTTTCGC
ATCAGAATGGTGCTGTTGAGAATGATCTTGAGTACTACGATTCGACAGATGATGAAGATGAAGACAATGATGAAGATGGA
GGTATTGTTGATCTTGAAGATATTGCTGGAAAAGCTCCTTCAAAGAGAAATGGCATAGTTAAAGTCACTAAAGGCGATGG
AAAGAAAGAAATGGTGACCCCTGTGATTAGAGCAAGCTTAACGAAACAGGGATATAAAATCATTGGTTCGCATAGCGGGG
TTAAAATATGTAGATGGACTAAGTCACAACTTAGAGGCAGGGGAGGTTGCTATAAGCACTCCTTTTATGGCATTGAGAGT
CACAGGTGCATGGAGACAACACCCAGTTTGGCTTGTGCAAACAAATGTGTCTTTTGTTGGAGACATCACACAAATCCTGT
TGGGAAAAGCTGGCAGTGGAAGATGGACGAGCCTTCAGTTATTGTGAAAGGTGCTCTAGATCTTCATACCAAGATGATTA
AGCAAATGAAAGGAGTTCCAGGTGTAACTGCAGAGAAATTACAAGAAGGTCTAAACCCAAGACATTGTGCGTTGTCACTT
GTTGGTGAACCCATTATGTATCCGGAGATCAATGCCCTTGTAGATGAGCTACATGGAAGGCGTATTTCTACATTTTTGGT
TACTAATGCACAGTTCCCCGAGAAGATTTTGATGATGAAGCCTATCACCCAGTTGTACGTAAGTGTAGATGCTGCCACCA
AAGAGAGCTTGAAAGCTATTGACAGGCCTCTCTTTGCAGACTTTTGGGAACGTTTTATTGACTCCTTGAAAGCTCTCCAT
GAGAAGCAGCAGCGAACTGTCTACCGTTTAACACTTGTCAAAGGATGGAACACAGAGGAGCTAGATGCTTATTTCAACCT
TTTCAGCATTGGGAAACCTGATTTCATCGAGATCAAAGGCGTCACATATTGTGGAACATCTGCAACATCAAAGTTGACAA
TGGAGAATGTACCGTGGCACGCAGACGTGAAAGCATTTTCAGAAGCTCTGTCTTCGAAGAGCAAAGGGGAGTACGAAGTT
GCTTGCGAACATGCCCATTCCTGCTGTGTTCTTCTAGGGAGAACCGAGAAGTTCAAAGTGAATGGAAAGTGGTTCACTTG
GATTGACTATGAAAAGTTCCACGATCTGGTTGCTTCTGGAGAACCATTCACGAGCTCAGACTATATGGCTCAAACACCAT
CATGGGCGGTTTATGGAGCAGAGGAAGGTGGGTTTGATCCAGAGCAGTTGCGTTTCAAGAAGGAAAGGCATCACCATCCT
AAACCGCAGGCGGTTTTAGCTTAA