Details for Capsella Locus Carubv10019888m

Position : scaf_2 ( 5`- 11683522 .. 11689977 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10019888m

Protein [Map View]
MRLHQSLVVFFCLFLSCFALSSSALPLCSDSRAPLEVNSTVSFCPYKVKTCCNTIEDSNLNKQFQAMNISDKGCASVVKS
ILCAKCDPYSSDLFRGNSDQQSVPILCNSTSSANSTMDFCSETWETCQNVSISGSLFAASLQGRAGAPANNNASKLADLW
QSKTDFCSAFGGASSNETVCFSGEPVTLSDTTPDKSPSGLCLEKIGNGSYLNMVPHPDGSNRAFFSTQPGIVFLAGIPDQ
DSGGVLDVDPSSPFVDLTDEIHFDTEFGMMGMAFHPKFAQNGRFFASFNCDKSKWPGCTGRCSCNSDVNCDPSKVTPDSG
SQPCQYQTVIAEYTTNGTSADPSKAKNAKPTEVRRIFTMGLPFTSHHAGQILFGPDGYLYFMMGDGGGGADPYNFSQNKK
SLLGKIMRLDVDNIPSASEISKMGLWGNYSIPKDNPFREDKDLEPEIWAVGLRNPWRCSFDSSRPSYFMCADVGQDTYEE
VDLITKGGNYGWRVYEGPDLFHPESSPGGNTSVKSVKTIFPVMGYNHSEVDSSGKSASITGGYFYRSETDPCLAGMYVYA
DLYGNGVWAGIETPVNSGNFVTNRTTFNCASDSPMKCSDSPGSSGPSLGYVFSFGEDNNKDIYMLTSNGVYRVVRPSRCN
LTCSKENSTAARRNPGRSSSPSSSSSNYKHMNGFHGSLMVLFVSLSLIMLRSLN*

DNA
ATGAGGCTTCATCAATCTCTTGTGGTGTTCTTCTGTTTGTTTCTGTCATGCTTCGCTCTTTCTTCCTCGGCTCTGCCTCT
TTGCTCCGATTCAAGAGCTCCATTGGAGGTGAATTCGACAGTGAGCTTTTGTCCTTACAAAGTAAAAACATGCTGCAATA
CGATTGAAGATTCCAATTTGAATAAGCAATTCCAAGCTATGAACATTTCCGACAAGGGTTGTGCTTCTGTTGTAAAGTCA
ATCCTTTGTGCTAAATGCGATCCTTATTCATCGGACTTATTCAGAGGTAATTCAGATCAACAGTCTGTTCCAATCCTCTG
CAACTCTACCAGCTCAGCAAATTCCACGATGGACTTTTGCTCTGAGACATGGGAGACATGTCAAAACGTTTCCATATCGG
GTTCTCTTTTCGCTGCTTCATTGCAAGGCCGAGCTGGAGCTCCAGCAAATAACAATGCCTCCAAGCTTGCTGATCTATGG
CAGTCCAAAACCGATTTCTGTAGTGCCTTTGGTGGAGCTAGCTCCAATGAAACTGTTTGCTTCAGTGGTGAGCCTGTTAC
TCTTAGTGACACTACTCCTGACAAGTCGCCTTCTGGTCTATGCCTTGAGAAAATCGGTAACGGTTCTTACCTCAACATGG
TTCCTCACCCTGATGGCTCGAACCGTGCCTTCTTCTCTACACAACCTGGAATAGTATTCTTGGCTGGTATACCGGATCAG
GATTCAGGCGGGGTATTGGATGTGGATCCATCTAGCCCGTTTGTGGATTTGACTGATGAGATTCATTTTGATACTGAGTT
TGGGATGATGGGAATGGCTTTTCATCCAAAGTTTGCTCAAAATGGGAGGTTTTTTGCTTCTTTCAACTGTGATAAGTCCA
AGTGGCCGGGATGTACTGGAAGGTGCTCATGTAACTCCGATGTGAACTGTGATCCTTCTAAAGTAACCCCTGATAGTGGA
TCTCAACCATGCCAATACCAAACCGTAATAGCTGAGTATACAACCAATGGCACCTCGGCAGACCCTTCTAAGGCAAAGAA
CGCTAAGCCAACAGAAGTCAGGAGGATTTTCACAATGGGACTTCCCTTCACATCTCACCATGCTGGACAGATTCTCTTTG
GTCCAGATGGTTACCTATACTTCATGATGGGAGATGGAGGTGGAGGCGCAGACCCATATAATTTCTCACAGAACAAGAAA
TCTTTGCTAGGAAAGATCATGAGGCTTGACGTAGATAACATTCCTAGTGCTTCTGAGATCTCCAAAATGGGTCTATGGGG
AAACTACTCTATACCAAAAGACAACCCTTTCCGTGAAGACAAAGATCTTGAACCTGAGATATGGGCAGTTGGGTTGAGAA
ACCCATGGAGATGCAGCTTTGATTCTTCTAGACCTTCTTACTTCATGTGTGCTGATGTTGGACAGGATACATATGAAGAG
GTGGATCTTATTACCAAAGGAGGGAACTACGGTTGGCGTGTTTACGAAGGCCCGGATCTTTTCCATCCGGAATCATCCCC
TGGAGGAAACACATCCGTTAAATCAGTAAAGACGATATTTCCCGTGATGGGTTACAACCACTCTGAAGTTGACTCAAGCG
GAAAATCAGCTTCAATCACTGGAGGATACTTCTATAGATCAGAGACTGATCCTTGCCTAGCTGGAATGTACGTGTATGCT
GATCTATATGGAAATGGCGTATGGGCGGGGATTGAAACGCCTGTTAATAGCGGGAACTTTGTGACCAACAGAACAACCTT
CAACTGTGCCAGCGACTCACCCATGAAATGTAGTGATTCTCCAGGATCTTCAGGGCCATCTCTAGGGTATGTCTTCTCCT
TTGGTGAGGATAACAACAAAGACATCTACATGCTCACAAGCAACGGTGTTTATAGAGTGGTAAGGCCGAGCCGTTGCAAC
TTGACTTGCTCAAAGGAGAACTCCACGGCAGCTAGAAGAAACCCTGGTCGCTCTAGTTCTCCTTCTTCATCGTCTTCTAA
TTATAAGCATATGAATGGTTTCCATGGAAGCTTGATGGTTTTATTCGTGTCTCTGTCTTTGATTATGCTACGTTCATTAA
ACTAG