Details for Capsella Locus Carubv10019862m

Position : scaf_2 ( 5`- 11753846 .. 11759266 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10019862m

Protein [Map View]
MQLSMELPVFSTLRVPLFSRLALVPAFGIPFSSHGATARLKCTARKARRVCVTCLVRDSARVETCERDEHGAEFIEVVVI
GSRKESIINSCLDSPFPSLPLRFWSISKDSSGDLVLQQRSNQEDNFSKTMNSIQLIQSRPRAFILVASAGYGSDQVEAMN
ILAAVRSGGNLAVAVLLKPFSFEGRKRLEEVNELARKLQQHTNFCIDIDIEVLLQKDLVTLDEALRNANNAVSMAINAAS
ALISGIHGNFIGVMDKDIKELESSEVTTILESYKEAKVGFGVGHNLKTSILRAIYDSPFFRPGIKDLNAIICIMASSVPL
QKKDVKTILRTFRQTMEYTGDIIVSTVHEPDLEPKVRVTTFFIRSSSEEETSNKGNIFSGLVPYVLNIFTRYRSQLQRET
NSGLKEVPVSIKDSADPTDLKRSSQKVKGFEIDSEDLLEVSENSDSEYPLKEREPSIDSRLELEDENIEDYGAIQREPIA
NWSMDPGYQNEQKWPANSGDTAVLSLGIVNLPVGVRHSKNLNSSLSVASQPSRKADSRDESFFNPDGSTKEPNDTASGLL
AEKYADFTKQKNLSARAASMLEAERDSSKRWSPILEMQYRGGLFKGRCQGGLPEGKGRLVLGDGSIYDGMWHNGKRSGLG
TFYFKNGDVFQGTWREDLIHGKGWFYFHKGDRWFANFWKGKASGEGRFYSKSGEIFFGHFKDGWRHGQFLCIDVDGTRYS
ESWDEGVLIDRKQVDAED*

DNA
ATGCAGCTTTCTATGGAGCTTCCTGTTTTCTCCACTCTCCGAGTACCATTGTTCTCTCGTTTAGCTCTCGTTCCTGCTTT
TGGCATTCCGTTTTCGTCCCATGGCGCTACGGCGCGATTGAAATGTACGGCTCGAAAGGCGCGTCGGGTTTGTGTGACAT
GCTTGGTGAGGGATTCGGCTCGTGTGGAGACGTGCGAGAGAGATGAGCATGGAGCTGAGTTCATTGAGGTCGTTGTCATC
GGTAGTCGCAAGGAGTCTATCATAAATTCTTGCTTGGATTCTCCTTTTCCTTCTCTTCCTCTCCGCTTTTGGAGTATTAG
CAAAGACAGCTCTGGAGATTTAGTGTTACAGCAGCGGTCCAATCAAGAAGATAATTTTTCCAAGACCATGAATTCAATTC
AGCTGATACAATCACGTCCAAGGGCCTTCATCCTTGTGGCTAGTGCTGGATATGGTTCTGATCAGGTTGAAGCTATGAAT
ATTCTTGCTGCAGTAAGATCTGGTGGTAACTTAGCTGTTGCTGTGCTGTTAAAGCCTTTCAGCTTTGAAGGCCGAAAGCG
TCTAGAAGAGGTTAACGAATTGGCTAGAAAACTGCAGCAACACACCAATTTCTGTATAGATATCGACATAGAGGTTTTAC
TACAGAAGGATTTGGTAACTTTGGACGAGGCACTGAGAAATGCAAACAATGCTGTTTCCATGGCAATAAATGCAGCTTCC
GCTCTGATAAGTGGGATACATGGAAACTTCATTGGCGTGATGGATAAAGATATTAAAGAACTGGAAAGTTCAGAAGTTAC
AACGATTCTAGAAAGCTACAAAGAGGCAAAGGTTGGTTTTGGAGTTGGCCACAACCTTAAGACTTCGATTTTACGAGCTA
TATATGACTCCCCATTCTTTCGTCCTGGTATAAAGGATCTAAACGCTATTATATGCATTATGGCTAGTTCGGTGCCTCTC
CAGAAGAAGGATGTGAAAACAATTCTTCGTACTTTTCGTCAAACAATGGAGTACACTGGAGATATTATAGTATCTACTGT
TCATGAACCTGATTTGGAGCCTAAAGTGCGTGTCACAACGTTTTTTATTAGAAGTTCTTCAGAAGAGGAAACTTCCAACA
AAGGCAACATTTTTTCTGGTCTTGTTCCTTATGTTTTAAATATCTTCACGAGATATCGTTCACAGCTACAAAGAGAAACT
AATAGTGGACTTAAAGAGGTGCCAGTTTCGATTAAAGATTCAGCAGACCCTACTGACTTAAAAAGATCCAGTCAGAAAGT
TAAAGGATTTGAAATCGACTCTGAGGACCTCCTCGAAGTTTCTGAGAACAGTGATAGTGAATACCCATTAAAAGAGAGAG
AACCATCCATAGACAGTCGATTGGAGCTCGAAGATGAAAATATAGAAGATTATGGTGCTATCCAGAGGGAGCCAATTGCT
AATTGGAGTATGGATCCGGGATATCAGAATGAGCAGAAATGGCCAGCTAATTCTGGAGACACTGCAGTGCTTAGCCTGGG
TATTGTCAACCTTCCTGTTGGTGTGAGACATTCAAAGAATTTGAACAGTAGTCTAAGTGTCGCCAGCCAACCCTCGAGGA
AGGCTGATTCGAGAGATGAATCATTTTTCAACCCTGATGGCTCGACTAAAGAACCTAATGATACTGCATCTGGCCTGCTA
GCTGAGAAATATGCTGATTTTACAAAGCAAAAGAATTTATCCGCTCGAGCAGCATCTATGCTGGAAGCTGAACGAGATTC
ATCAAAAAGATGGAGTCCTATTCTGGAGATGCAGTACAGAGGAGGACTGTTCAAGGGAAGGTGCCAAGGAGGTCTTCCCG
AAGGAAAGGGTCGTCTGGTACTTGGAGATGGAAGCATATATGATGGAATGTGGCACAACGGTAAAAGATCTGGTCTCGGA
ACATTCTACTTCAAGAATGGAGACGTATTCCAAGGCACATGGAGAGAAGATTTAATACACGGAAAGGGGTGGTTTTATTT
CCACAAAGGTGATCGATGGTTTGCAAATTTCTGGAAAGGAAAAGCCAGTGGCGAAGGCCGGTTCTATTCGAAGTCGGGTG
AGATATTCTTTGGACATTTCAAAGATGGATGGCGGCACGGGCAGTTCCTCTGTATAGACGTGGATGGAACAAGATACTCT
GAGAGTTGGGACGAAGGCGTTCTTATAGACCGGAAACAAGTGGACGCCGAAGATTAA