Details for Capsella Locus Carubv10019820m

Position : scaf_2 ( 5`- 11805172 .. 11809350 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10019820m

Protein [Map View]
NEHTEQNYWVPSNSGRRIQSEMMSDEQLSPIGESSVPVPNRMLRRLKKAKSISDLCPGSETLDFESSDGDDLGKLYLSQS
EKGFDGFEEEDGLRSDNEGLGVEDGVTAKKVLGFDSVSEFNQPIEDLGEKGEEDEISDLKTSAETRVSETTEDGPVSAPE
FDSPIEESGEKGEDEICDLESQEEFKDSETKEAGKKRQVPETSENKRDKKRNKKSDDFDELPISTASMNMTKKERREYLD
QLRAENQRLLRETRDAAFEPAPLVRKPISSVLEKIRRRKEEISKQFISRKKSKSNDICDQDDFEEVVAEDKNEGMNLDST
SNQHPGRQHCSEDSAGPSGNLNSPSNKRADNDPTHQDPSLRPQMNNSGDELLEKMSSRPLEEVMTPSVVAMNLKLNLSPL
PEKSSKEAEYMKENSDSETNDDSSPGDPVRKFIDEDAEEEDDSDNDLLRFEDEDDDEDEEDDDLRDMIVSQFKEDPTDKD
RRNELHQKWLEQQDAAGTEKLLQKLKRGLQQDETLLSEDEVDDDDDEERAEDADDEEVQKPEANEDENEDEEDPSHANSM
RMTIKKIKEMIPLMFTDVDDVYVSSDDEEMEKKLMQQRLHRKMELKAKSSSSIGDENSEEILRHIKKPEIKKKEKPSSYK
ERALMGMNKNPAASKSSFLGRLTKSSVSEGSRKRGLNVVRGYIFERDDSNGKSSNSVPEEPSVPETIIQEKSKPKRAPAK
FTASQSQERSATLQETTVVKETSTRQRATLYEILKMSSKKTCFNSHETVISRSHTESIFAAFKLDKKTVKTNPQEKR*

DNA
AACGAACATACAGAACAGAACTATTGGGTACCATCTAATTCTGGCCGGAGAATACAATCGGAGATGATGAGCGACGAGCA
GCTTTCTCCTATCGGAGAATCGAGTGTCCCAGTTCCAAATAGGATGCTTAGGCGATTGAAGAAGGCTAAATCGATTTCCG
ATTTATGTCCTGGATCTGAAACCCTCGATTTCGAAAGTTCCGACGGTGATGATTTAGGGAAGCTTTATTTATCGCAGTCT
GAGAAGGGTTTCGATGGGTTTGAAGAAGAAGATGGGCTACGATCTGATAACGAGGGTTTGGGTGTGGAGGATGGAGTCAC
CGCGAAAAAGGTACTCGGTTTTGATTCAGTGTCTGAGTTTAACCAGCCGATTGAAGATCTGGGTGAGAAAGGTGAAGAAG
ACGAAATCTCTGATTTGAAGACAAGTGCGGAAACTAGGGTTTCCGAAACGACGGAGGATGGGCCAGTTAGTGCGCCGGAG
TTTGACTCCCCAATCGAGGAATCGGGCGAGAAAGGTGAAGACGAGATCTGTGATTTGGAATCACAAGAGGAATTTAAGGA
TTCGGAAACGAAGGAAGCTGGAAAGAAGCGACAAGTTCCGGAGACAAGTGAGAACAAGAGAGATAAGAAAAGGAACAAGA
AGAGTGATGACTTTGATGAGCTGCCAATTTCTACTGCTTCCATGAACATGACTAAGAAGGAAAGAAGAGAATATCTTGAC
CAGCTTCGTGCAGAAAACCAGAGACTTTTGCGAGAAACTAGAGATGCTGCCTTTGAACCCGCCCCTCTTGTCCGGAAGCC
GATTTCATCCGTGTTGGAGAAAATTAGGCGACGGAAAGAGGAGATTTCAAAACAATTCATTAGCAGGAAGAAATCCAAAT
CTAATGACATATGCGACCAGGATGATTTTGAGGAAGTTGTAGCCGAAGATAAGAATGAAGGTATGAACTTAGACAGTACA
AGCAATCAGCACCCTGGAAGACAGCATTGCTCCGAGGACTCTGCAGGTCCATCGGGGAACTTAAACAGTCCATCTAACAA
AAGAGCTGATAATGACCCTACTCATCAGGATCCCTCCTTGCGTCCACAAATGAATAACTCTGGAGATGAACTTCTAGAGA
AGATGTCAAGCAGACCTTTGGAAGAAGTAATGACACCTTCGGTAGTTGCCATGAACCTCAAACTAAATTTGTCTCCTCTG
CCTGAGAAATCTTCTAAAGAAGCAGAATACATGAAGGAAAATTCTGATTCTGAGACCAATGATGATTCATCTCCTGGTGA
CCCTGTTAGAAAATTTATTGATGAGGATGCTGAAGAGGAAGATGACAGCGACAATGATTTACTCCGATTTGAGGATGAGG
ATGATGACGAAGATGAAGAAGATGATGATCTCAGGGATATGATTGTCAGTCAATTTAAGGAAGATCCAACTGATAAAGAT
AGACGTAATGAACTGCATCAGAAGTGGCTCGAGCAACAAGATGCTGCAGGGACAGAGAAACTCTTACAGAAGCTAAAACG
TGGTCTGCAGCAGGATGAAACATTATTATCTGAGGATGAAGTTGATGATGACGATGATGAAGAGAGGGCTGAAGATGCTG
ATGATGAAGAAGTGCAAAAACCTGAAGCCAATGAAGATGAAAACGAAGATGAAGAAGATCCGAGTCATGCAAATTCCATG
CGAATGACCATAAAGAAAATAAAGGAAATGATCCCCTTAATGTTTACAGATGTAGATGATGTTTATGTGTCATCCGACGA
TGAGGAAATGGAAAAGAAGCTTATGCAACAGCGATTACACAGGAAAATGGAGCTAAAGGCCAAGTCTTCATCATCTATTG
GGGATGAAAACTCTGAGGAAATTCTTCGCCACATCAAGAAGCCTGAGATCAAGAAGAAAGAAAAACCTTCTTCTTATAAA
GAGAGGGCACTCATGGGAATGAACAAAAACCCTGCAGCATCCAAGTCATCATTCTTGGGTAGACTTACAAAGAGTTCCGT
ATCAGAAGGATCTCGCAAGCGCGGTTTAAATGTTGTACGTGGCTATATATTTGAACGTGATGACAGTAACGGCAAAAGCT
CAAACTCAGTGCCAGAGGAACCTTCAGTTCCGGAAACGATTATTCAAGAAAAGAGCAAACCAAAAAGAGCTCCGGCAAAA
TTCACTGCCTCACAGTCACAAGAAAGATCAGCAACATTACAGGAGACGACGGTGGTGAAGGAGACAAGCACGAGGCAACG
AGCAACCTTATACGAGATTCTAAAGATGTCTTCAAAGAAAACTTGCTTCAATTCACACGAGACAGTGATAAGCAGGAGCC
ACACTGAATCTATATTTGCTGCTTTCAAATTGGATAAAAAAACAGTGAAGACGAATCCACAAGAGAAGAGATGA