Details for Capsella Locus Carubv10019733m

Position : scaf_2 ( 5`- 11669858 .. 11673942 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10019733m

Protein [Map View]
MAVLDFKESLKLKDGNEIFMLRVVIWLCVPNLLGEQNKLEASIFDGHRGRRPNSPSISLVFFLIFSLRFILCFVVWGKRS
RRRKSNTTVLKTMIRAKHISNLSSSARSFFLSGTRPSAADGNSCTGAEDESCVSKRQQIRTEVVQTGKRASNLAAGLAGN
ILPAEAGKPLVVPKTVEHFTRTTLLPQHVSSPALPGKADSLNHASAIIKDDVGAPIGDQIFNAGSGTVNLLSDVGNYKIP
LSDGTKVIGLPKSSMVDPTRPILSVKSSNVKVNRREHLAKVYPRSTSKDSSDRVPINSSPGTKQASNDVAENSFEPYDLL
SNTTSGKRKSMPQRHNIDSTRYASGDCDYNVHSSGDRTMISSGKPSTEMMRVTAPTPRQYCNPGYIVENVSSILRRFKWG
HATEEALHNFGFRMDAYQANQILKQMDNYVNALGFFYWLKRQPGFKHDGHTYTTMVGNLGRAKQFGAINKLLDEMVGDGC
QPNTVTYNRLIHSYGRANYLSEAMNVFNQMQEAGCEPDRVTYCTLIDIHAKAGFLDIAMDMYQRMQAAGLSPDTFTYSVI
INCLGKAGHLPAAHRLFCEMVGQGCTPNLVTFNIMIALHAKARNYQTALKLYRDMQNAGFQPDKVTYSIVMEVLGHCGFL
EEAEGVFAEMQRKNWVPDEPVYGLLVDLWGKAGNVEKAWQWYQAMLHAGLRPNVPTCNSLLSTFLRVHRMSEAYNLLQSM
LVLGLHPSLQTYTLLLSCCTDARSKFDMGFCGQLMAVSGHPAHMFLLKMPPAGPDGQNVRDHVSNFLDFMHSEDRESKRG
LMDAVVDFLHKSGLKEEAGSVWEVAAVKNVYPDALREKSCSYWLINLHVMSEGTAVIALSRTLAWFRKQMLVSGDCPSRI
DIVTGWGRRSRVTGTSMVRQAVEELLNIFNFPFFTENGNSGCFVGCGEPLKKWLLESYVERMHLL*

DNA
ATGGCAGTATTGGATTTTAAGGAATCACTGAAACTTAAAGATGGAAACGAAATATTTATGTTGAGGGTCGTAATTTGGTT
GTGTGTGCCCAATTTGCTTGGAGAGCAAAACAAACTTGAAGCTTCCATTTTTGACGGCCACAGAGGGAGAAGGCCAAATT
CGCCTTCTATCTCTCTCGTTTTCTTTCTCATTTTCTCCTTAAGATTTATTTTGTGTTTTGTTGTCTGGGGAAAACGAAGC
AGACGGAGGAAGTCCAACACCACCGTTTTGAAGACAATGATTCGTGCAAAGCACATTAGTAATCTTTCCAGTTCAGCCAG
ATCCTTTTTTCTTAGTGGAACGAGACCTAGTGCAGCTGATGGAAATTCTTGTACAGGCGCTGAGGATGAAAGTTGCGTCT
CAAAACGCCAGCAAATTAGGACTGAAGTTGTACAGACTGGTAAAAGAGCATCAAATTTAGCAGCTGGACTAGCTGGAAAT
ATATTACCTGCAGAGGCTGGTAAACCGCTGGTGGTCCCAAAGACGGTTGAGCATTTCACCCGCACAACTCTTCTTCCGCA
GCATGTATCCTCTCCTGCTTTGCCGGGGAAAGCAGATTCTCTAAATCATGCTTCTGCTATTATTAAAGATGATGTGGGTG
CACCTATTGGGGATCAGATATTCAATGCTGGTAGTGGAACTGTAAATTTATTGTCAGATGTAGGAAACTATAAGATCCCT
TTATCAGATGGAACTAAAGTCATTGGTTTGCCTAAAAGCTCTATGGTTGATCCTACTCGGCCTATTTTGAGTGTTAAGTC
TTCAAATGTGAAAGTCAACAGAAGGGAGCACCTTGCCAAAGTCTACCCTAGGTCCACTTCCAAAGATTCATCAGACCGAG
TTCCTATAAATAGCTCTCCAGGTACTAAGCAAGCATCAAATGACGTTGCGGAGAATTCTTTTGAACCTTATGATTTACTC
TCAAACACTACCTCTGGAAAAAGGAAAAGCATGCCACAAAGACACAATATTGATTCGACTAGGTATGCATCGGGTGATTG
TGACTATAATGTGCATTCTTCTGGTGACAGGACGATGATATCTTCTGGTAAGCCTTCAACGGAAATGATGAGAGTGACTG
CTCCAACACCTAGGCAGTATTGTAACCCTGGCTACATTGTAGAAAATGTTTCTAGTATATTGCGGAGATTCAAATGGGGA
CATGCTACTGAAGAGGCCCTTCACAATTTTGGTTTCAGGATGGATGCATACCAAGCAAACCAAATTCTTAAGCAGATGGA
TAATTATGTGAATGCGCTTGGTTTCTTCTATTGGCTGAAAAGGCAACCTGGGTTTAAGCATGATGGGCATACTTATACCA
CCATGGTAGGTAATCTTGGTCGTGCAAAGCAATTTGGTGCAATAAACAAGCTCCTTGATGAGATGGTTGGAGATGGATGT
CAGCCAAACACTGTTACATATAATCGACTTATTCATAGCTATGGTCGCGCAAATTATCTCAGTGAAGCTATGAATGTTTT
TAATCAAATGCAAGAGGCTGGATGTGAGCCTGATCGAGTAACTTACTGTACCCTTATAGACATCCACGCTAAAGCTGGAT
TTCTTGACATTGCCATGGACATGTACCAGAGGATGCAAGCAGCGGGGCTTTCTCCTGATACTTTCACCTACAGTGTTATA
ATAAATTGTCTTGGAAAAGCAGGCCATTTACCTGCTGCCCATAGACTCTTTTGTGAAATGGTTGGTCAAGGTTGTACCCC
TAATTTGGTCACATTCAACATCATGATAGCTTTGCATGCCAAGGCACGGAATTATCAGACTGCGTTGAAGCTCTACCGAG
ACATGCAAAATGCCGGGTTTCAACCTGACAAAGTGACATACAGTATAGTTATGGAGGTGCTTGGACACTGTGGATTTCTC
GAGGAAGCAGAGGGTGTTTTCGCTGAGATGCAACGTAAGAACTGGGTTCCTGATGAACCGGTTTACGGTCTTTTAGTGGA
CTTGTGGGGAAAAGCTGGCAATGTGGAAAAAGCTTGGCAATGGTATCAAGCAATGCTTCACGCTGGTCTTCGACCTAATG
TTCCCACTTGTAATTCCCTTCTCAGCACTTTCCTTAGGGTTCACAGGATGTCTGAAGCCTATAACTTATTACAAAGCATG
CTGGTGCTTGGTCTACATCCTTCTTTGCAGACATACACGTTGCTATTGAGTTGTTGCACAGATGCTCGTTCAAAATTTGA
CATGGGATTTTGTGGTCAGCTAATGGCAGTCTCTGGTCATCCGGCTCACATGTTTCTCCTCAAAATGCCACCTGCAGGTC
CTGATGGCCAAAATGTGCGTGATCATGTCAGCAACTTTCTGGATTTTATGCACAGTGAGGATAGAGAGAGCAAGCGGGGA
CTCATGGACGCAGTAGTGGATTTTCTCCACAAGTCAGGTCTAAAAGAAGAGGCTGGCTCAGTATGGGAAGTGGCTGCAGT
TAAGAATGTGTATCCAGATGCATTGAGGGAGAAAAGCTGCAGCTATTGGCTTATCAATCTTCATGTAATGTCAGAAGGAA
CTGCAGTCATCGCACTTTCTAGGACACTTGCGTGGTTCCGTAAGCAGATGTTGGTTTCAGGTGACTGTCCTTCACGGATT
GATATAGTAACTGGTTGGGGAAGGCGAAGTAGAGTCACTGGCACGTCGATGGTAAGACAAGCAGTTGAAGAATTGCTCAA
CATCTTCAACTTCCCGTTTTTCACTGAGAATGGGAACTCAGGCTGTTTTGTAGGATGCGGAGAGCCTCTCAAGAAGTGGT
TGCTTGAATCATATGTTGAGAGAATGCATTTGCTCTAG