Details for Capsella Locus Carubv10019701m

Position : scaf_2 ( 5`- 11658999 .. 11662656 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10019701m

Protein [Map View]
MNTTPFHSDPPPPPSRIQRRLVVEVVEARNILPKDGQGSSSAYVVVDFDAQKKRTSTKFRDLNPVWNEMLDFSVSDPKNM
DYDELDVEVYNDKRFGNGGGRKNHFLGRVKIYGSQFSRRGEEGLVYFPLEKKSVFSWIRGEIGLKIYYYDEAAADDMAVG
GGDQQQQQQQHFHQQQQDDADEQHQRHHHQQQQQQFHPPPQQMMNLPPEKPNVVVVEEGRVFESAQSHSYPETHQQPPVV
IVEESQPQQVMQGPNDNHPQRPPSPPPPPSAGDVHYYPPEVRKMQVGRPPGGDRIRVTKRPQNGDYSPRVINSKIGGGET
TMEKKTHHPYNLVEPMQYLFVRIVKARGLPPNESAYVKVRTSNHFVRSKPAVNRPGESVDSPEWNQVFALGHNRSDSAVT
GATLEISAWDASSESFLGGVCFDLSEVPVRDPPDSPLAPQWYRLEGSAADQNSGRVSGDIQLSVWIGTQVDEAFPEAWSS
DAPHVAHTRSKVYQSPKLWYLRVTVLEAQDLHIAPNLPPLTAPEVRVKAQLGFQSARTRRGSMNNHSGSFHWHEDMIFVA
GEPLEDCLVLMVEDRTTKEATMLGHAMIPVSSIEQRIDERFVPSKWHTLEVEGGGGGGGPGGGPYCGRISLRLCLEGGYH
VLEEAAHVCSDFRPTAKQLWKPPIGILELGILGARGLLPMKAKNGGKGSTDAYCVAKYGKKWVRTRTITDSFDPRWHEQY
TWQVYDPCTVLTVGVFDNWRMFSDVSDDRPDTRIGKIRIRVSTLESNKVYTNSYPLLVLLPSGLKKMGEIEVAVRFACPS
LLPDVCAAYGQPLLPRMHYIRPLGVAQQDALRGAATKMVAAWLARAEPPLGPEVVRYMLDADSHAWSMRKSKANWYRIVG
VLAWAVGLAKWLDNIRRWRNPVTTVLVHILYLVLVWYPDLVVPTAFLYVVMIGVWYYRFRPKIPAGMDIRLSQAETVDPD
ELDEEFDTIPSSRRPEVIRARYDRLRILAVRVQTILGDFAAQGERIQALVSWRDPRATKLFIAICLVITIVLYAVPAKMV
AVALGFYYLRHPMFRDTMPTASLNFFRRLPSLSDRLI*

DNA
ATGAACACGACGCCGTTTCACTCTGATCCTCCTCCTCCTCCTTCCAGGATCCAGCGTAGGCTCGTCGTCGAGGTTGTCGA
AGCTCGCAATATCCTCCCTAAAGATGGCCAAGGCAGCTCTAGCGCCTACGTCGTTGTCGATTTCGATGCTCAGAAGAAAC
GTACCTCCACCAAGTTCCGCGACCTTAACCCTGTCTGGAACGAGATGCTCGATTTCTCCGTCTCCGATCCCAAAAACATG
GACTACGACGAGCTCGATGTCGAGGTTTACAACGACAAGCGATTCGGCAACGGAGGTGGCCGCAAAAATCATTTTCTCGG
TAGGGTTAAGATCTACGGAAGCCAGTTCTCTAGGAGAGGCGAGGAAGGTCTTGTGTATTTCCCCTTGGAGAAGAAGAGTG
TTTTCAGCTGGATTCGCGGCGAGATTGGACTCAAAATCTACTATTACGACGAAGCCGCCGCCGACGATATGGCCGTTGGA
GGCGGAGACCAGCAACAACAACAACAACAGCACTTTCATCAGCAGCAACAAGATGATGCTGATGAACAACATCAACGCCA
TCATCATCAACAACAACAGCAACAGTTTCATCCTCCGCCGCAGCAGATGATGAATTTACCACCGGAGAAACCTAATGTAG
TTGTCGTTGAAGAAGGTAGGGTTTTCGAATCGGCTCAGAGTCATAGCTATCCGGAGACTCATCAGCAACCTCCGGTGGTT
ATCGTTGAAGAGTCACAACCTCAGCAGGTAATGCAAGGTCCAAATGATAACCACCCTCAACGGCCGCCGTCTCCGCCGCC
ACCTCCATCGGCGGGGGATGTACATTATTATCCTCCCGAAGTGAGGAAGATGCAGGTAGGCAGACCTCCCGGCGGCGATA
GAATTAGGGTTACGAAGAGGCCACAGAATGGGGATTACTCGCCTAGGGTTATCAACAGCAAAATTGGAGGAGGAGAGACG
ACGATGGAGAAGAAGACTCACCATCCTTACAATCTCGTTGAGCCAATGCAGTATCTCTTCGTTCGGATTGTGAAGGCGCG
TGGCTTACCGCCTAACGAGAGCGCGTATGTTAAGGTACGGACGTCCAACCATTTCGTCAGGTCTAAACCGGCCGTTAACC
GGCCCGGCGAATCGGTTGATTCTCCGGAGTGGAATCAGGTTTTTGCTCTTGGTCATAACCGGTCCGACTCTGCTGTAACC
GGTGCGACTCTTGAGATCTCTGCTTGGGATGCTTCGTCGGAGAGTTTCCTCGGTGGAGTGTGTTTTGATTTATCTGAGGT
TCCTGTTCGTGACCCGCCGGATAGTCCGCTTGCTCCTCAGTGGTATCGGCTTGAAGGCTCCGCTGCGGATCAGAACTCTG
GGAGAGTTTCCGGTGATATTCAGCTCTCTGTTTGGATTGGTACTCAGGTAGATGAAGCTTTTCCGGAGGCGTGGAGCTCC
GACGCTCCGCATGTAGCTCACACGCGTTCGAAGGTGTATCAATCACCGAAGCTTTGGTACTTGAGAGTGACGGTTCTTGA
GGCACAGGATTTACACATTGCCCCCAACCTTCCGCCATTGACTGCGCCTGAGGTCCGTGTGAAAGCTCAATTAGGCTTTC
AGTCTGCGCGTACAAGACGAGGCTCAATGAATAACCACAGTGGTTCCTTTCATTGGCATGAGGATATGATCTTCGTAGCC
GGAGAGCCATTGGAAGATTGCTTGGTTCTGATGGTAGAAGACAGGACGACTAAAGAAGCAACTATGTTAGGACACGCCAT
GATCCCAGTGAGCTCCATCGAGCAGCGTATTGATGAGCGTTTTGTGCCGTCAAAATGGCACACTTTGGAAGTAGAAGGTG
GAGGAGGTGGAGGAGGACCAGGAGGTGGACCTTATTGTGGAAGGATTAGCCTAAGACTTTGTCTAGAAGGTGGGTATCAC
GTGCTTGAAGAGGCAGCGCATGTGTGCAGCGATTTCCGCCCGACAGCTAAGCAGCTCTGGAAACCGCCAATTGGAATACT
TGAGTTGGGTATTCTTGGAGCTCGTGGGTTGTTGCCGATGAAAGCTAAAAATGGAGGGAAAGGTTCCACTGATGCTTATT
GTGTTGCTAAGTATGGCAAGAAATGGGTCCGAACTCGAACCATAACAGACAGTTTCGACCCGAGATGGCACGAGCAGTAC
ACATGGCAGGTTTATGATCCTTGCACCGTGCTAACAGTTGGTGTCTTCGACAATTGGAGAATGTTCTCTGACGTCTCTGA
TGACAGACCCGATACACGGATTGGGAAAATACGGATCCGGGTCTCGACGTTAGAGAGCAACAAAGTGTACACCAATTCAT
ATCCTTTATTGGTCTTGTTACCTAGCGGTCTGAAGAAAATGGGTGAGATCGAAGTGGCAGTCCGGTTCGCATGCCCGTCG
TTGCTTCCTGATGTTTGTGCAGCTTATGGACAGCCGCTTCTGCCTCGGATGCACTACATAAGGCCTCTAGGTGTAGCACA
ACAGGATGCATTAAGAGGAGCAGCCACGAAAATGGTAGCAGCTTGGCTGGCTCGAGCAGAACCACCATTGGGACCTGAGG
TGGTGCGGTATATGTTGGATGCAGATTCGCATGCGTGGAGCATGAGAAAGAGCAAAGCAAATTGGTATAGAATTGTTGGT
GTTTTAGCTTGGGCAGTGGGTTTAGCTAAATGGTTGGATAATATACGGCGGTGGAGGAATCCTGTGACAACGGTGCTAGT
CCATATTCTATATCTGGTTCTTGTTTGGTATCCTGATTTGGTAGTTCCGACTGCATTCTTGTACGTGGTGATGATTGGCG
TTTGGTATTACCGGTTTAGACCCAAGATTCCGGCTGGTATGGATATCCGCTTATCACAAGCCGAAACTGTTGATCCTGAT
GAGCTAGATGAAGAATTCGATACCATACCAAGCTCAAGGCGACCAGAAGTAATCCGAGCTAGGTACGACCGGTTAAGGAT
CTTAGCGGTAAGGGTTCAGACCATTCTAGGCGATTTTGCAGCGCAAGGCGAACGGATTCAGGCGCTGGTTAGCTGGAGAG
ATCCAAGAGCGACCAAACTCTTCATAGCAATATGTTTGGTGATCACAATAGTTCTTTATGCGGTTCCAGCGAAAATGGTG
GCAGTGGCTCTAGGGTTTTATTATCTTCGGCATCCGATGTTCAGAGACACAATGCCAACGGCGAGTCTCAATTTTTTCCG
GCGGTTGCCAAGCTTGTCAGATCGGCTCATATAA