Details for Capsella Locus Carubv10019575m

Position : scaf_5 ( 5`- 11243650 .. 11244854 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10019575m

Protein [Map View]
MGTTNLLTASNGIKLNGVNFVSSFSDKPNYHLAHYLARCLSQTTRRVRTLCCSRETSLKAVTSLERPEAETSSDTDGIGI
VRFLKGKSYLVTSGTGFLGKASPEIGKVYLLMRSKNQESAEKTLCDEIISSDLFKLLKQMHGSSYEAFMKSKLIPVIGDI
GEDNLGMESEIRDKISEEIDVIISCGGRTTFDDRLDDTNTTSLIEEMSMKERKMFGFDIKGIDWEHYVVNVHLPGLKKEL
LSVKRLI*

DNA
ATGGGTACTACAAATCTCCTCACTGCAAGCAACGGTATCAAATTGAATGGTGTCAACTTCGTCTCCTCTTTCTCAGACAA
ACCTAACTACCACTTAGCTCACTACTTGGCTCGTTGTTTGTCACAGACGACTCGTAGAGTCCGTACTTTATGTTGTTCTC
GTGAGACGTCTCTGAAAGCTGTGACGTCGTTAGAGAGGCCTGAGGCAGAAACAAGTAGTGACACTGACGGAATTGGAATC
GTCCGTTTTTTAAAAGGGAAAAGTTACCTCGTTACGAGTGGAACAGGGTTTCTTGGCAAAGCAAGTCCTGAGATTGGGAA
GGTATACCTTCTGATGAGATCCAAAAATCAAGAATCAGCCGAAAAGACACTCTGTGATGAGATTATAAGCTCGGATCTGT
TCAAGCTTCTGAAGCAAATGCACGGGAGCTCTTACGAAGCCTTCATGAAGAGTAAGTTGATTCCAGTAATTGGAGACATT
GGAGAAGACAATCTAGGGATGGAATCTGAAATAAGAGACAAGATTAGTGAGGAAATTGATGTCATTATCAGTTGTGGTGG
TCGTACAACATTTGACGACAGGCTTGACGACACCAATACAACGAGTCTGATAGAGGAGATGTCAATGAAAGAGAGAAAGA
TGTTTGGGTTCGATATCAAAGGCATTGACTGGGAGCATTACGTTGTCAACGTTCATCTTCCTGGCCTCAAAAAGGAACTT
CTTTCAGTGAAGAGACTGATTTAA