Details for Capsella Locus Carubv10019566m

Position : scaf_5 ( 5`- 11190435 .. 11192180 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10019566m

Protein [Map View]
MCEKARVIVRMLQGCNSMKKLRKIHSHVIINGLQHHPSIFNHLLRFCAVSVTGSLPYALLLFDRFDSDPSTSAWNSLIRG
FSISSSPLYSLLFYNRMLHSSVSRPDIFTFSFALKACERLRSIPKCLELHGSIIRSGFPADAIVSTSLVRCYSANASVDT
ASKLFDEMPVRDLVSWNAMISCFSHAGLHHQALDMYKRMETEGLCVDAYTLVALLSSCAHVSALNMGLMLHRIACDIQCE
SSVFVSNALIDMYAKCGSLENAVGVFNRMHKRDVLTWNSMIIGYGVHGHGLEAISFFRRMLASGVRPNAITFLGLLLGCS
HQGLVNEGVEHFEIMTSQFHVIPSIKHYGCMVDLYGRAGQLAKALEMIHTSSCHEDPVLWRTLLGSCKIHSNVELGEVAM
KNLVQLKAFNAGDYVLMTSIYSAGNDTQGFASMRKLIRSHDLRTIPGWSWIEIGDQVHKFVVDEKMHPESALIYSELREV
IHRAILAGYKPEDSNRTAPTLSDGCLGSADTFHSEKLAIAYGLMRTPAGTTLRITKNLRVCRDCHSFTRFVSKAFNRKII
VRDRVRFHHFASAHCSCNEYW*

DNA
ATGTGCGAGAAAGCGAGAGTGATAGTGAGAATGCTGCAAGGCTGCAACAGCATGAAAAAGCTCCGTAAGATCCACTCTCA
TGTCATCATCAATGGTCTCCAACATCATCCTTCCATCTTTAACCATCTCCTCCGCTTCTGCGCCGTCTCCGTCACCGGCT
CTTTACCTTACGCTCTGCTTCTCTTCGACCGTTTCGATTCTGATCCATCAACTTCGGCTTGGAACTCCCTTATCCGTGGC
TTCTCCATTTCCTCTTCTCCTCTCTATTCGCTTCTCTTCTATAATCGAATGCTTCACTCCTCTGTTTCACGTCCCGATAT
CTTTACTTTCAGTTTTGCTCTCAAAGCCTGTGAGAGGCTACGTTCGATTCCGAAGTGTTTGGAGCTTCACGGTTCGATTA
TTCGTTCTGGGTTTCCTGCTGATGCTATTGTTTCCACTAGTCTTGTTCGTTGTTACTCTGCGAATGCAAGTGTTGACACT
GCATCCAAATTGTTCGACGAAATGCCTGTTAGAGACTTGGTTTCTTGGAACGCTATGATCTCCTGCTTTTCTCATGCTGG
TTTACATCATCAGGCCTTGGATATGTACAAGCGAATGGAAACTGAAGGTTTGTGCGTCGACGCTTACACGCTAGTTGCTT
TGTTATCGTCTTGTGCTCACGTTAGTGCTTTGAATATGGGACTTATGCTACACAGGATCGCCTGTGACATCCAATGTGAG
AGCAGTGTCTTTGTGAGTAATGCTCTTATTGATATGTACGCAAAATGTGGTAGCCTTGAAAATGCTGTGGGGGTTTTTAA
CAGGATGCACAAGAGAGATGTCTTGACCTGGAACTCAATGATCATTGGGTATGGAGTTCATGGGCATGGCCTAGAGGCCA
TCTCTTTTTTTAGAAGGATGTTGGCTTCCGGGGTTAGACCCAATGCCATCACATTCCTCGGCTTGTTGCTAGGTTGTAGT
CATCAAGGTCTAGTTAACGAAGGAGTTGAGCATTTTGAAATCATGACTTCACAGTTCCATGTGATCCCAAGCATTAAACA
CTATGGATGCATGGTGGATCTCTATGGAAGAGCAGGTCAACTAGCAAAGGCCCTCGAGATGATTCACACGTCTTCCTGCC
ATGAAGACCCTGTATTATGGAGAACCCTACTTGGCTCTTGCAAAATCCACAGTAATGTGGAATTAGGAGAAGTGGCCATG
AAGAATTTGGTGCAGCTCAAGGCTTTTAATGCAGGGGATTATGTGCTTATGACTTCGATATATTCTGCAGGTAATGATAC
GCAAGGTTTTGCGAGTATGAGAAAACTAATAAGAAGCCATGATTTACGGACAATTCCAGGCTGGAGCTGGATTGAGATTG
GTGATCAAGTTCACAAATTTGTCGTTGATGAAAAAATGCATCCCGAGTCTGCACTTATTTATTCAGAACTCAGGGAAGTA
ATCCACCGAGCCATTCTTGCTGGTTACAAGCCAGAGGACTCAAACAGAACTGCTCCTACCCTCTCTGATGGGTGTTTAGG
ATCTGCTGATACATTTCACAGTGAAAAATTGGCTATTGCATATGGATTGATGAGAACTCCTGCAGGAACTACTCTCCGGA
TCACAAAGAATCTGAGAGTTTGCAGAGATTGTCATTCTTTTACAAGATTTGTATCAAAAGCTTTCAATCGAAAAATTATT
GTAAGGGATCGAGTTCGATTTCATCACTTTGCAAGTGCTCATTGTTCTTGCAACGAGTACTGGTGA