Details for Capsella Locus Carubv10019449m

Position : scaf_5 ( 5`- 11231734 .. 11233911 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10019449m

Protein [Map View]
MAEPPLEELPDTSLTFSSIAIPPLSVVDFCNSTSDRQALLGNSISDLIENDGDGDFDFTFADSIGDLYFPSENESFFTPL
DATNLELFRGFTPASGISGEDDADKNDNGVLISTSASCDQESPKDSDCSDTTTHSLSSSTPELVNYVSHILEATNASSSL
GSAQMVIDQKLKVEEEATTYKTSIPKRRKEIDEEDTSNESWNNKYRRMDRDGFAGIGVAEDDQKRNVRLIRNRESAHLSR
QRKRHYVEELEDKVKIMHSTICDLNSKMSFFMAENVTLRHQVSSGSNIYLPLQPRPGIYSVPYPCLPYPAYMVKPQGSQV
ALLPIPRLKPQQSVAKVKKFKKVASFSVLGILFCLFLFGALAPIVNISYKSNYVTDWVYDQSRGRVLDVNGYLDVSVNSN
RAHCGRDSDQEMGRNVSATETSGPPRNSSEPLVASLFVPRNDKLVKIDGNLIIHSITESEKSMATETKNEGGKCDESTTN
KGDFHALPLPDSTKTDDMSKNIYSKKRKALSSSGYNDASEDQLKSTTTANGKMQQWFREGVAGPMFSSGMCTSVFQFDVS
TTSGAIIPASPPIQQSEHTTDTHKGKQNRRILRGGLPVSDFNLTKEHNSSSNKTLQDTKPSTSMIVSVLVDPREGGEGDI
DGMMGVTKSLSRVFIVLLVDDVKYVTYSCVLPQPEVPHLMTT*

DNA
ATGGCGGAACCACCTCTGGAGGAGCTTCCTGACACTTCTCTTACTTTCTCTTCCATCGCCATCCCTCCTCTTTCAGTTGT
TGATTTCTGCAATTCTACCTCCGATCGTCAAGCTCTCCTTGGGAACTCGATCTCCGACCTGATCGAAAACGACGGAGACG
GAGACTTCGATTTCACTTTTGCAGACAGTATTGGTGACCTTTATTTTCCATCTGAGAACGAATCCTTCTTCACTCCTCTT
GACGCTACCAATCTAGAATTGTTCCGTGGATTTACGCCGGCGTCGGGAATTTCAGGCGAAGATGACGCGGATAAGAATGA
TAACGGCGTGTTGATTTCTACTTCAGCCTCCTGCGATCAGGAATCGCCTAAGGATTCTGATTGCTCCGATACTACTACTC
ATAGCTTGAGTTCATCGACTCCAGAGTTGGTGAATTACGTCTCTCATATCCTGGAAGCTACAAATGCGTCGTCTTCACTT
GGATCCGCACAAATGGTGATCGATCAGAAACTTAAGGTGGAGGAGGAAGCCACTACGTATAAGACATCTATTCCGAAGAG
GAGAAAAGAGATTGATGAAGAAGATACCAGCAACGAATCTTGGAACAACAAGTACAGGAGAATGGATCGAGATGGTTTTG
CAGGTATTGGTGTCGCAGAAGATGATCAGAAGAGGAACGTGAGACTCATTAGAAACCGTGAAAGTGCTCACCTTTCAAGA
CAGAGGAAGAGACATTACGTTGAGGAGTTAGAAGATAAAGTCAAGATTATGCATTCCACTATATGTGATTTGAACAGTAA
GATGTCTTTTTTCATGGCTGAAAATGTCACTTTGAGGCACCAGGTGAGCTCCGGAAGTAATATATATCTACCACTTCAGC
CACGGCCTGGAATATATTCAGTGCCTTATCCATGTTTGCCGTATCCGGCTTATATGGTTAAACCTCAGGGTTCTCAAGTG
GCTTTGCTTCCTATTCCTCGATTGAAACCACAACAATCCGTGGCTAAGGTGAAGAAGTTCAAGAAGGTTGCTAGTTTTAG
TGTTCTTGGTATTCTGTTTTGTCTATTTTTGTTTGGTGCATTGGCTCCCATTGTGAACATTAGCTATAAGTCTAACTACG
TCACTGACTGGGTTTATGATCAGTCTAGAGGGAGAGTTTTGGATGTTAATGGTTACTTGGATGTGTCTGTTAATAGTAAC
AGAGCACATTGTGGGAGAGATTCTGATCAAGAAATGGGAAGAAACGTTTCTGCAACAGAGACCTCGGGGCCTCCTCGAAA
TAGTAGTGAACCTCTAGTTGCATCTCTATTTGTTCCGAGGAATGACAAGCTTGTGAAGATCGATGGAAATTTGATTATTC
ATTCTATTACGGAGAGTGAGAAATCCATGGCTACTGAAACGAAGAACGAAGGAGGGAAATGCGATGAATCAACTACTAAT
AAAGGTGATTTTCATGCATTGCCTTTACCTGACTCGACAAAGACCGATGATATGTCTAAGAACATCTATAGCAAGAAGCG
GAAAGCCCTGTCATCGTCTGGCTATAATGATGCTTCAGAAGACCAACTAAAATCAACAACAACAGCCAATGGTAAAATGC
AGCAATGGTTTCGTGAAGGTGTTGCAGGGCCAATGTTCAGTTCAGGGATGTGCACCAGCGTTTTTCAGTTCGATGTCTCC
ACAACCTCAGGCGCCATCATTCCTGCTTCTCCACCTATTCAACAGTCTGAGCACACCACTGATACACACAAGGGAAAACA
GAATAGAAGAATCCTCCGTGGTGGTCTTCCGGTATCTGATTTTAATCTTACCAAAGAGCATAACAGCTCAAGCAACAAGA
CCCTCCAGGACACCAAGCCTTCCACGTCAATGATTGTTTCTGTGCTTGTTGATCCCAGAGAAGGCGGTGAAGGAGACATT
GACGGGATGATGGGAGTAACAAAATCACTGTCCCGAGTTTTTATAGTCTTGCTTGTGGACGATGTGAAGTATGTAACATA
CTCATGCGTTCTTCCACAACCTGAAGTCCCTCATCTCATGACCACTTGA